Comparing N515DRAFT_0393 N515DRAFT_0393 glucokinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
38% identity, 93% coverage: 14:324/333 of query aligns to 2:308/320 of 1sz2B
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
28% identity, 50% coverage: 112:277/333 of query aligns to 130:318/374 of 8dtcA
Sites not aligning to the query:
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
27% identity, 64% coverage: 110:321/333 of query aligns to 128:371/374 of 6vzzA
Sites not aligning to the query:
>N515DRAFT_0393 N515DRAFT_0393 glucokinase
MQERAWGAVVPRPKLVLAADVGGTHARIGLVDAAAPAGASGVLAYERYAGADWPGLAEIL
ADFLARHPGHAVDEAAIAVAGYVRDGELVAENLRWPVRLAELRERLRLRRLQVVNDFEAL
AFATQYLGADDSLAVIDAPAAAGPVAVVGPGTGLGCALLVPDGNGVTVLPSEGGHVALAP
GSEREMALLQLLSRGRDYVHTGHVLSGPGLVNLYRAIGELDGLSAVHAQPEQISAAALDG
GDALALDTLHTFCAMLGGFVGDLAVLFKASGGVFLAGGILPQLREFLPYSAFRERFFNKG
VMRDFLAGVPVRLIEHGRLGVLGAAGLAARAEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory