SitesBLAST
Comparing N515DRAFT_0878 FitnessBrowser__Dyella79:N515DRAFT_0878 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
38% identity, 94% coverage: 16:340/345 of query aligns to 13:338/339 of 1rjwA
- active site: C38 (= C41), H39 (≠ G42), T40 (≠ A43), H43 (≠ A46), H61 (= H63), E62 (= E64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), K110 (≠ P113), C148 (= C151), T152 (≠ A155), R331 (= R333)
- binding trifluoroethanol: T40 (≠ A43), C148 (= C151), I285 (= I287)
- binding zinc ion: C38 (= C41), H61 (= H63), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
38% identity, 94% coverage: 16:339/345 of query aligns to 13:337/337 of P12311
- C38 (= C41) mutation to S: No activity.
- T40 (≠ A43) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ A46) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
38% identity, 94% coverage: 16:339/345 of query aligns to 13:337/337 of 3piiA
- active site: C38 (= C41), H39 (≠ G42), T40 (≠ A43), H43 (≠ A46), H61 (= H63), E62 (= E64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), K110 (≠ P113), C148 (= C151), T152 (≠ A155), R331 (= R333)
- binding butyramide: T40 (≠ A43), H61 (= H63), W87 (≠ R90), C148 (= C151)
- binding zinc ion: C38 (= C41), H61 (= H63), E62 (= E64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), C148 (= C151)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
38% identity, 94% coverage: 16:338/345 of query aligns to 13:336/336 of 6iqdA
- active site: C38 (= C41), T40 (≠ A43), H43 (≠ A46), H61 (= H63), C148 (= C151)
- binding zinc ion: C38 (= C41), H61 (= H63), E62 (= E64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), C148 (= C151)
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
34% identity, 96% coverage: 16:345/345 of query aligns to 13:345/345 of 4z6kA
- active site: C38 (= C41), H39 (≠ G42), T40 (≠ A43), H43 (≠ A46), H61 (= H63), E62 (= E64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), Q110 (≠ P113), C148 (= C151), T152 (≠ A155), R331 (= R333)
- binding zinc ion: C38 (= C41), H61 (= H63), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), C148 (= C151)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
34% identity, 93% coverage: 16:336/345 of query aligns to 13:334/338 of Q8GIX7
- C38 (= C41) binding
- H61 (= H63) binding
- E62 (= E64) binding
- C92 (= C95) binding
- C95 (= C98) binding
- C98 (= C101) binding
- C106 (= C109) binding
- C148 (= C151) binding
3s2fE Crystal structure of furx nadh:furfural
35% identity, 94% coverage: 16:340/345 of query aligns to 15:340/340 of 3s2fE
- active site: C40 (= C41), H41 (≠ G42), T42 (≠ A43), H45 (vs. gap), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ P113), C150 (= C151), T154 (≠ A155), R333 (= R333)
- binding furfural: T42 (≠ A43), W51 (≠ R50), H63 (= H63), W89 (≠ R90), C150 (= C151), I287 (= I287)
- binding nicotinamide-adenine-dinucleotide: C40 (= C41), H41 (≠ G42), T42 (≠ A43), C150 (= C151), T154 (≠ A155), G174 (= G175), G176 (= G177), G177 (= G178), L178 (= L179), D197 (≠ G198), I198 (≠ R199), K202 (≠ I203), T239 (= T239), A240 (≠ I240), V241 (≠ A241), N262 (≠ L262), G263 (= G263), L264 (≠ V264), I287 (= I287), V288 (≠ T288), R333 (= R333)
- binding zinc ion: C40 (= C41), H63 (= H63), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C151)
3s2fA Crystal structure of furx nadh:furfural
35% identity, 94% coverage: 16:340/345 of query aligns to 15:340/340 of 3s2fA
- active site: C40 (= C41), H41 (≠ G42), T42 (≠ A43), H45 (vs. gap), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ P113), C150 (= C151), T154 (≠ A155), R333 (= R333)
- binding phosphorylisopropane: T42 (≠ A43), H63 (= H63), W89 (≠ R90), I287 (= I287)
- binding zinc ion: C40 (= C41), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C151)
3s2eE Crystal structure of furx nadh complex 1
35% identity, 94% coverage: 16:340/345 of query aligns to 15:340/340 of 3s2eE
- active site: C40 (= C41), H41 (≠ G42), T42 (≠ A43), H45 (vs. gap), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ P113), C150 (= C151), T154 (≠ A155), R333 (= R333)
- binding nicotinamide-adenine-dinucleotide: C40 (= C41), H41 (≠ G42), T42 (≠ A43), C150 (= C151), T154 (≠ A155), G176 (= G177), G177 (= G178), L178 (= L179), D197 (≠ G198), I198 (≠ R199), K202 (≠ I203), T239 (= T239), A240 (≠ I240), V241 (≠ A241), S242 (≠ H242), A245 (≠ T245), N262 (≠ L262), G263 (= G263), L264 (≠ V264), I287 (= I287), V288 (≠ T288)
- binding zinc ion: C40 (= C41), H63 (= H63), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C151)
3s2eA Crystal structure of furx nadh complex 1
35% identity, 94% coverage: 16:340/345 of query aligns to 15:340/340 of 3s2eA
- active site: C40 (= C41), H41 (≠ G42), T42 (≠ A43), H45 (vs. gap), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ P113), C150 (= C151), T154 (≠ A155), R333 (= R333)
- binding zinc ion: C40 (= C41), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C151)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
34% identity, 94% coverage: 16:338/345 of query aligns to 20:342/344 of 6n7lC
- active site: C45 (= C41), T47 (≠ A43), H50 (≠ A46), H68 (= H63), C154 (= C151)
- binding nicotinamide-adenine-dinucleotide: C45 (= C41), H46 (≠ G42), T47 (≠ A43), H50 (≠ A46), C154 (= C151), T158 (≠ A155), G178 (= G175), G180 (= G177), G181 (= G178), L182 (= L179), D201 (≠ G198), V202 (≠ R199), K206 (≠ I203), T243 (= T239), A244 (≠ I240), V245 (≠ A241), S246 (≠ H242), A249 (≠ T245), N266 (≠ L262), G267 (= G263), L268 (≠ V264), I291 (= I287), V292 (≠ T288)
- binding zinc ion: C45 (= C41), H68 (= H63), C98 (= C95), C101 (= C98), C104 (= C101), C112 (= C109), C154 (= C151)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
35% identity, 98% coverage: 1:338/345 of query aligns to 2:341/341 of 1lluA
- active site: C43 (= C41), H44 (≠ G42), T45 (≠ A43), H48 (≠ A46), H66 (= H63), E67 (= E64), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), Q115 (≠ P113), C153 (= C151), T157 (≠ A155), R336 (= R333)
- binding 1,2-ethanediol: H44 (≠ G42), T45 (≠ A43), L47 (≠ A45), D53 (≠ A51), W92 (≠ R90), C153 (= C151)
- binding nicotinamide-adenine-dinucleotide: C43 (= C41), H44 (≠ G42), T45 (≠ A43), H48 (≠ A46), C153 (= C151), T157 (≠ A155), G179 (= G177), G180 (= G178), L181 (= L179), D200 (≠ G198), I201 (≠ R199), K205 (≠ I203), A243 (≠ T239), V244 (≠ I240), S245 (≠ A241), A248 (= A244), V265 (= V264), L267 (≠ A266), I290 (= I287), V291 (≠ T288), R336 (= R333)
- binding zinc ion: C43 (= C41), H66 (= H63), C100 (= C98), C103 (= C101), C111 (= C109), C153 (= C151)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
34% identity, 97% coverage: 4:338/345 of query aligns to 2:340/341 of 3meqA
- active site: C40 (= C41), H41 (≠ G42), T42 (≠ A43), H45 (≠ A46), H63 (= H63), E64 (= E64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), L112 (≠ P113), C150 (= C151), T154 (≠ A155), R335 (= R333)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C41), H41 (≠ G42), T42 (≠ A43), H45 (≠ A46), C150 (= C151), T154 (≠ A155), G176 (= G177), G177 (= G178), L178 (= L179), D197 (≠ G198), I198 (≠ R199), K202 (≠ I203), T241 (= T238), A242 (≠ T239), V243 (≠ I240), S244 (≠ A241), A247 (= A244), N264 (≠ G263), G265 (= G265), L266 (≠ A266), I289 (= I287), V290 (≠ T288)
- binding zinc ion: C40 (= C41), H63 (= H63), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C151)
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 89% coverage: 30:336/345 of query aligns to 30:342/349 of P0CH37
- K210 (≠ D202) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 89% coverage: 30:336/345 of query aligns to 30:342/349 of P0CH36
- K210 (≠ D202) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 97% coverage: 5:339/345 of query aligns to 7:344/346 of P9WQC5
- K209 (≠ D202) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
35% identity, 94% coverage: 16:338/345 of query aligns to 16:335/336 of 6z42A
- active site: C41 (= C41), T43 (≠ A43), H46 (≠ A46), H64 (= H63), C148 (= C151)
- binding zinc ion: C41 (= C41), H64 (= H63), E65 (= E64), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), C148 (= C151)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
33% identity, 90% coverage: 30:338/345 of query aligns to 33:347/367 of 5z0cA
- active site: C44 (= C41), S46 (≠ A43), H49 (≠ A46), H66 (= H63), C160 (= C151)
- binding zinc ion: C44 (= C41), H66 (= H63), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), C160 (= C151)
6c49A Crystal structure of alcohol dehydrogenase from acinetobacter baumannii
33% identity, 91% coverage: 27:341/345 of query aligns to 27:337/338 of 6c49A
7bu2B Structure of alcohol dehydrogenase yjgb from escherichia coli (see paper)
33% identity, 97% coverage: 1:336/345 of query aligns to 1:333/339 of 7bu2B
Query Sequence
>N515DRAFT_0878 FitnessBrowser__Dyella79:N515DRAFT_0878
MKDTYRAMQIAASGVLELVERPTPVPQHGEVLIEVEACGICGADAADIERANPATRPPRV
PGHEVVGRIAALGPGTPSTWKLGQRVGVGRLGGHCNQCDECRRGQFQLCRDQPVLGATCD
GGYAEMMVARSTGLVSIPDELRAEEAAPILCAGIATFNALKKCGAEAGDLVAVVGVGGLG
HMALQYARRMGFKVAAIGRGQDIAGDALALGAHVYIDTNEQDAGARLKDLGGAQAIITTI
AHAATVSALVAGLAPQGRLVVLGVGAEPLSIPLGQLVAGERSILGSITGTPYENEKTLEF
SVLAGVRAMIETMPLERAPDAYRRMKRGEAKFRMVLTMEQANRPH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory