SitesBLAST
Comparing N515DRAFT_0956 FitnessBrowser__Dyella79:N515DRAFT_0956 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
28% identity, 65% coverage: 7:285/428 of query aligns to 4:275/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (= G13), H11 (≠ P14), A12 (= A15), D34 (≠ A35), E35 (≠ Q36), R42 (vs. gap), P43 (= P37), S46 (≠ G40), K47 (≠ G41), R78 (≠ H72), M79 (≠ S73), T106 (= T102), R127 (≠ G123), I153 (≠ L148), D275 (≠ E285)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
30% identity, 52% coverage: 64:287/428 of query aligns to 71:283/443 of 6rvhA
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 63, 303, 307, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 297, 298, 299, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
30% identity, 52% coverage: 64:287/428 of query aligns to 71:283/443 of 6rvbA
- active site: Y159 (≠ P147), E163 (≠ A151)
- binding flavin-adenine dinucleotide: E80 (≠ S73), V81 (= V74), T113 (= T102), G114 (= G103), L133 (vs. gap), R134 (vs. gap), I160 (≠ L148), G280 (= G284), D281 (≠ E285)
- binding nicotinamide-adenine-dinucleotide: G156 (= G144), G158 (= G146), Y159 (≠ P147), I160 (≠ L148), E179 (≠ H176), A180 (= A177), A240 (≠ G241), T241 (≠ Y242), G242 (= G243)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 63, 303, 307, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 298, 299, 424, 425
- binding nicotinamide-adenine-dinucleotide: 297, 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
30% identity, 52% coverage: 64:287/428 of query aligns to 71:283/443 of 6ruzA
- active site: Y159 (≠ P147), E163 (≠ A151)
- binding flavin-adenine dinucleotide: E80 (≠ S73), V81 (= V74), T113 (= T102), G114 (= G103), A115 (= A104), L133 (vs. gap), R134 (vs. gap), Y159 (≠ P147), G280 (= G284), D281 (≠ E285)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 63, 303, 307, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 297, 298, 299, 424, 425
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
21% identity, 66% coverage: 3:285/428 of query aligns to 5:276/308 of 3f8dA
- active site: C133 (≠ L128), A136 (≠ Q131), D137 (≠ G132)
- binding flavin-adenine dinucleotide: V12 (= V10), G13 (= G11), L14 (≠ A12), G15 (= G13), P16 (= P14), A17 (= A15), G36 (≠ D34), E37 (≠ A35), T38 (≠ Q36), G41 (= G41), Q42 (= Q42), E45 (≠ R45), A46 (≠ H46), V49 (≠ R49), D51 (≠ N51), I82 (≠ Q71), V83 (≠ H72), G109 (≠ A101), I110 (≠ T102), G111 (= G103), C133 (≠ L128), A136 (≠ Q131), G275 (= G284), D276 (≠ E285)
Sites not aligning to the query:
6tukB Crystal structure of fdr9 (see paper)
30% identity, 52% coverage: 93:314/428 of query aligns to 93:282/393 of 6tukB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 9, 10, 12, 34, 35, 42, 43, 47, 75, 76, 311, 312
4jnaA Crystal structure of the deph complex with dimethyl-fk228 (see paper)
29% identity, 70% coverage: 5:303/428 of query aligns to 5:286/296 of 4jnaA
- binding flavin-adenine dinucleotide: S13 (≠ G13), H14 (≠ P14), A15 (= A15), I33 (≠ L33), D34 (= D34), A35 (= A35), A37 (vs. gap), R39 (≠ Q36), N40 (≠ P37), S46 (≠ R45), H47 (= H46), S80 (≠ G80), V81 (≠ A81), F110 (≠ T102), C136 (≠ K130), H137 (≠ Q131), G266 (= G284), D267 (≠ E285), G273 (= G291), T274 (vs. gap), V275 (≠ L292)
- binding : C133 (≠ A127), H270 (≠ G288), R271 (≠ I289), G272 (= G290)
Sites not aligning to the query:
4jn9A Crystal structure of the deph (see paper)
29% identity, 70% coverage: 5:303/428 of query aligns to 8:289/299 of 4jn9A
- binding flavin-adenine dinucleotide: G14 (= G11), S16 (≠ G13), A18 (= A15), I36 (≠ L33), D37 (= D34), A38 (= A35), A40 (vs. gap), R42 (≠ Q36), S49 (≠ R45), H50 (= H46), S83 (≠ G80), V84 (≠ A81), F113 (≠ T102), C139 (≠ K130), H140 (≠ Q131), G269 (= G284), D270 (≠ E285), G276 (= G291), T277 (vs. gap), V278 (≠ L292)
- binding magnesium ion: S49 (≠ R45), H50 (= H46), V52 (= V48), Q55 (≠ N51)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 45% coverage: 93:285/428 of query aligns to 101:284/422 of P16640
- R134 (≠ Q126) binding
- D284 (≠ E285) binding
Sites not aligning to the query:
- 15 binding
- 37 binding
- 50 binding
- 83 binding
- 302 binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
30% identity, 45% coverage: 93:285/428 of query aligns to 100:283/422 of 1q1wA
Sites not aligning to the query:
- active site: 13, 44, 45, 305
- binding flavin-adenine dinucleotide: 10, 12, 13, 14, 35, 36, 44, 45, 49, 82, 300, 301, 329
2zbwB Crystal structure of thioredoxin reductase-like protein from thermus thermophilus hb8
23% identity, 67% coverage: 6:291/428 of query aligns to 6:292/334 of 2zbwB
- active site: P39 (≠ A39), L43 (≠ V43), L46 (vs. gap), K144 (vs. gap), S145 (vs. gap)
- binding flavin-adenine dinucleotide: V10 (= V10), G11 (= G11), G13 (= G13), P14 (= P14), T15 (≠ A15), V33 (≠ L33), D34 (= D34), P35 (≠ A35), G41 (= G41), Q42 (= Q42), L43 (≠ V43), Y47 (vs. gap), I52 (≠ R45), D54 (= D47), R86 (≠ H72), A87 (≠ S73), A115 (= A101), A116 (≠ T102), G117 (= G103), G119 (= G113), A120 (≠ W114), F121 (≠ T115), D286 (≠ E285)
Sites not aligning to the query:
Q5SL28 Ferredoxin--NADP reductase; FNR; Fd-NADP(+) reductase; EC 1.18.1.2 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
23% identity, 67% coverage: 6:291/428 of query aligns to 7:293/335 of Q5SL28
- T16 (≠ A15) binding
- D35 (= D34) binding
- Q43 (= Q42) binding
- Y48 (vs. gap) binding
- A88 (≠ S73) binding
- F122 (≠ T115) binding
- D287 (≠ E285) binding
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
27% identity, 53% coverage: 93:318/428 of query aligns to 107:327/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 332, 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
Query Sequence
>N515DRAFT_0956 FitnessBrowser__Dyella79:N515DRAFT_0956
MTERYDVLVVGAGPAGLAAAGTAAAHGARVGLLDAQPRAGGQVWRHDVRKNAPRAAREAI
AALHGVTLLAQHSVIASEDGALRVEIPQGSTLLTYGALVLATGARELLLPFPGWTLPGVS
GAGGLQALTKQGWPVAGKRVVVAGSGPLLLAAAATLRAHGAKLVGIHEQASAESVHAFAR
QLLHWPARATQAALLRAKLAGVPYRFGSVVRQAHGEDALRLVEIDGAHGTSLVDCDLLAV
GYGLVPNVELAQLLGCALDHGHPHPHVQVDELLRTSVPAILAAGEACGIGGLAVARIEGA
IAGHMAAGHQDDARALLPERDRARRFGALLARHFAPGARVHALATPQTLICRCEDVPLGA
LDGYADARDAKLATRCGMGACQGRICGTALAELGRFPRGAGRPPLFPARLATLAGLALSS
SDASRSST
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory