SitesBLAST
Comparing N515DRAFT_1217 FitnessBrowser__Dyella79:N515DRAFT_1217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
26% identity, 80% coverage: 92:467/468 of query aligns to 22:402/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (≠ Q93), G40 (≠ A110), L41 (≠ T111)
- binding 2-oxoglutaric acid: D213 (= D279), P214 (≠ V280), Y215 (= Y281), G216 (= G282), E217 (≠ D283), G241 (= G307), T242 (≠ S308), I246 (≠ S312)
- binding (2E)-pent-2-enedioic acid: G40 (≠ A110), Y130 (= Y200), N184 (= N250), R376 (= R441)
- binding glutamic acid: V22 (≠ L92), L131 (≠ H201), V360 (≠ S425), A364 (≠ L429), R369 (≠ G434)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G174), S105 (≠ A175), Q106 (≠ M176), Y130 (= Y200), N184 (= N250), D212 (= D278), P214 (≠ V280), Y215 (= Y281), T242 (≠ S308), S244 (= S310), K245 (= K311), R252 (= R318)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
26% identity, 80% coverage: 92:467/468 of query aligns to 22:402/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: V22 (≠ L92), R23 (≠ Q93), L131 (≠ H201), Q135 (= Q205), A364 (≠ L429), R369 (≠ G434)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (≠ Q93), G40 (≠ A110), Y130 (= Y200), L131 (≠ H201), A132 (≠ G202), N184 (= N250), R376 (= R441)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G174), S105 (≠ A175), Q106 (≠ M176), Y130 (= Y200), V179 (= V245), N184 (= N250), D212 (= D278), P214 (≠ V280), Y215 (= Y281), T242 (≠ S308), S244 (= S310), K245 (= K311), R252 (= R318)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
26% identity, 80% coverage: 92:467/468 of query aligns to 22:402/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (≠ Q93), Y70 (= Y140), Y130 (= Y200), L275 (≠ V340)
- binding pyridoxal-5'-phosphate: G104 (= G174), S105 (≠ A175), Q106 (≠ M176), Y130 (= Y200), V179 (= V245), N184 (= N250), D212 (= D278), P214 (≠ V280), Y215 (= Y281), T242 (≠ S308), S244 (= S310), K245 (= K311), R252 (= R318)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
26% identity, 80% coverage: 92:467/468 of query aligns to 22:402/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G174), S105 (≠ A175), Q106 (≠ M176), Y130 (= Y200), V179 (= V245), N184 (= N250), D212 (= D278), P214 (≠ V280), Y215 (= Y281), T242 (≠ S308), S244 (= S310), K245 (= K311), R252 (= R318)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
32% identity, 81% coverage: 85:461/468 of query aligns to 15:388/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (≠ L92), R23 (≠ Q93), G39 (≠ S109), G40 (≠ A110), G99 (= G174), S100 (≠ A175), Q101 (≠ M176), Y125 (= Y200), N174 (= N250), D202 (= D278), Y205 (= Y281), S235 (= S308), S237 (= S310), K238 (= K311), R245 (= R318), R368 (= R441)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
32% identity, 81% coverage: 85:461/468 of query aligns to 15:388/397 of Q72LL6
- S20 (≠ P90) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (≠ Q93) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (≠ A110) binding
- Y70 (= Y140) binding
- N174 (= N250) binding ; binding
- R245 (= R318) binding
- R368 (= R441) binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
32% identity, 81% coverage: 85:461/468 of query aligns to 11:384/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (≠ L92), R19 (≠ Q93), G35 (≠ S109), G36 (≠ A110), G95 (= G174), S96 (≠ A175), Q97 (≠ M176), Y121 (= Y200), N170 (= N250), D198 (= D278), Y201 (= Y281), S231 (= S308), S233 (= S310), K234 (= K311), R241 (= R318), R364 (= R441)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
32% identity, 81% coverage: 85:461/468 of query aligns to 11:384/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G174), S96 (≠ A175), Q97 (≠ M176), Y121 (= Y200), N170 (= N250), D198 (= D278), A200 (≠ V280), Y201 (= Y281), S231 (= S308), S233 (= S310), K234 (= K311), R241 (= R318)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
33% identity, 76% coverage: 104:461/468 of query aligns to 26:380/389 of 2z1yA
- binding leucine: G32 (≠ A110), Y117 (= Y200), R360 (= R441)
- binding pyridoxal-5'-phosphate: G91 (= G174), S92 (≠ A175), Q93 (≠ M176), Y117 (= Y200), N166 (= N250), D194 (= D278), Y197 (= Y281), S227 (= S308), S229 (= S310), K230 (= K311), R237 (= R318)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
27% identity, 80% coverage: 92:467/468 of query aligns to 19:400/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G174), S103 (≠ A175), Q104 (≠ M176), Y128 (= Y200), V177 (= V245), N182 (= N250), D210 (= D278), P212 (≠ V280), Y213 (= Y281), T240 (≠ S308), S242 (= S310), K243 (= K311), R250 (= R318)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
29% identity, 78% coverage: 104:467/468 of query aligns to 36:405/405 of 2zc0A
- active site: Y132 (= Y200), D214 (= D278), A216 (≠ V280), S246 (= S310)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G174), G107 (≠ A175), T108 (≠ M176), Y132 (= Y200), N186 (= N250), D214 (= D278), A216 (≠ V280), Y217 (= Y281), T244 (≠ S308), S246 (= S310), K247 (= K311), R254 (= R318)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
26% identity, 82% coverage: 82:463/468 of query aligns to 18:410/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G174), S113 (≠ A175), Q114 (≠ M176), Y138 (= Y200), N194 (= N250), D222 (= D278), P224 (≠ V280), Y225 (= Y281), T252 (≠ S308), S254 (= S310), K255 (= K311), R262 (= R318)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
29% identity, 89% coverage: 3:418/468 of query aligns to 10:410/458 of 7zlaB
- binding : L10 (= L3), Y11 (= Y4), S35 (= S28), K36 (≠ I29), R37 (= R30), K38 (≠ Q31), Q47 (≠ A40), Q47 (≠ A40), N48 (≠ A41), T49 (= T42), R68 (= R61)
Sites not aligning to the query:
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
31% identity, 78% coverage: 95:459/468 of query aligns to 12:383/388 of 8tn3A
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
28% identity, 89% coverage: 3:418/468 of query aligns to 7:387/435 of 7zn5B
Sites not aligning to the query:
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
25% identity, 78% coverage: 104:467/468 of query aligns to 76:442/464 of Q93703
- G171 (≠ T199) mutation to E: In qd182; reduces tyrosine aminotransferase activity by 90% and results in increased tyrosine levels. Delays development, increases embryonic lethality and results in germline defects in response to increased levels of meta-tyrosine, but not in response to increased levels of tyrosine (para-tyrosine). Delays the development to reproductive adults in response to oxidative stress induced by the superoxide paraquat, with only 4.9% developing into fertile adults. Increases dauer formation in an eak-4 mg348 mutant background. Reduces dauer formation in an eak-4 mg348 and aak-2 gt33 mutant background.
- P224 (= P251) mutation to S: Increases dauer formation in an eak-4 mg348 mutant background. Suppresses fah-1 RNAi-mediated toxicity.
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
24% identity, 82% coverage: 86:467/468 of query aligns to 12:425/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (≠ A110), L40 (≠ T111), Y74 (= Y140), S117 (≠ A175), Q118 (≠ M176), Y142 (= Y200), N202 (= N250), D230 (= D278), P232 (≠ V280), Y233 (= Y281), S260 (= S308), S262 (= S310), K263 (= K311), R270 (= R318), R399 (= R441)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
24% identity, 82% coverage: 86:467/468 of query aligns to 12:425/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (≠ L92), R20 (≠ Q93), T23 (≠ L96), G39 (≠ A110), L40 (≠ T111), Y74 (= Y140), S75 (≠ A141), S77 (≠ P143), S117 (≠ A175), Q118 (≠ M176), Y142 (= Y200), N202 (= N250), D230 (= D278), P232 (≠ V280), Y233 (= Y281), S260 (= S308), S262 (= S310), R270 (= R318), L293 (≠ V340), R399 (= R441)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
24% identity, 82% coverage: 86:467/468 of query aligns to 12:425/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (≠ L92), G39 (≠ A110), Y74 (= Y140), S75 (≠ A141), S77 (≠ P143), S117 (≠ A175), Q118 (≠ M176), Y142 (= Y200), N202 (= N250), D230 (= D278), P232 (≠ V280), Y233 (= Y281), S260 (= S308), S262 (= S310), R270 (= R318), L293 (≠ V340), R399 (= R441)
4gdyB Kynurenine aminotransferase ii inhibitors
24% identity, 82% coverage: 86:467/468 of query aligns to 12:425/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (≠ L92), M33 (≠ V104), G39 (≠ A110), Y74 (= Y140), S75 (≠ A141), G116 (= G174), S117 (≠ A175), Q118 (≠ M176), Y142 (= Y200), N202 (= N250), D230 (= D278), P232 (≠ V280), S260 (= S308), S262 (= S310), R270 (= R318), R399 (= R441)
Query Sequence
>N515DRAFT_1217 FitnessBrowser__Dyella79:N515DRAFT_1217
MLLYERLAGSLRGQIARGALRAGERLPSIRQLALGHGLSAATAVQACLQLEREGLVVARP
RSGYYVRAAVPPPPAAKPPRRRVPGAVNNPALQEVLDMLARSDVLPLHSATPSPALLPQA
ALTAALSRSLRHHPAAVLDYAPPQGLPALRRQIARRYAQLGAAVSPDEIVITAGAMEGIS
LALRTLAEPGDVVLVETPTYHGILQAVAALRLKVLEVPNLPGQGIDVARLDQLLQQNRVR
AAVLVPNFNNPLGSVTGDAAKQALLASCARHGTVVIEDDVYGDLAWSGERPSPLRRWDTR
GNLISCGSFSKSLSPGLRLGWIAAGAWTDALVRAKYFSTVGAASLPQLAMAEYLQKHDLE
RHLRRLRRALADNAQRLHEAISRHWPAGTRASEPRGGLSLWLQLPEGGDGQMLFEAALEQ
GIGTSPGVLFSSRGDYGDCLRLSCGMPWDARLEQALKKLGQLAARQLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory