SitesBLAST
Comparing N515DRAFT_1251 FitnessBrowser__Dyella79:N515DRAFT_1251 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8P3K2 L-fuconate dehydratase; FucD; EC 4.2.1.68 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
76% identity, 98% coverage: 9:440/442 of query aligns to 4:437/441 of Q8P3K2
- GSD 22:24 (= GSD 27:29) binding
- Y32 (= Y37) binding
- K218 (= K222) binding
- K220 (= K224) mutation to A: Inactive.
- D248 (= D252) binding
- N250 (= N254) binding
- E274 (= E278) binding ; binding
- E301 (= E304) binding ; binding
- HAG 351:353 (= HAG 354:356) binding
- E382 (= E385) binding
1yeyC Crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. Campestris str. Atcc 33913
76% identity, 97% coverage: 9:435/442 of query aligns to 4:432/435 of 1yeyC
- active site: T55 (= T59), T190 (= T194), K218 (= K222), K220 (= K224), D248 (= D252), N250 (= N254), E274 (= E278), G300 (= G303), E301 (= E304), D324 (= D327), P350 (= P353), H351 (= H354), A352 (= A355), D368 (= D371), K375 (≠ R378), E382 (= E385)
- binding magnesium ion: D248 (= D252), E274 (= E278), E301 (= E304)
2hxtA Crystal structure of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and d-erythronohydroxamate (see paper)
76% identity, 97% coverage: 9:435/442 of query aligns to 3:431/434 of 2hxtA
- active site: T54 (= T59), T189 (= T194), K217 (= K222), K219 (= K224), D247 (= D252), N249 (= N254), E273 (= E278), G299 (= G303), E300 (= E304), D323 (= D327), P349 (= P353), H350 (= H354), A351 (= A355), D367 (= D371), K374 (≠ R378), E381 (= E385)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G27), D23 (= D29), Y31 (= Y37), K217 (= K222), K219 (= K224), E300 (= E304), H350 (= H354), G352 (= G356), E381 (= E385)
- binding magnesium ion: D247 (= D252), E273 (= E278), E300 (= E304)
2hxuA Crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate (see paper)
76% identity, 97% coverage: 9:435/442 of query aligns to 3:431/434 of 2hxuA
- active site: T54 (= T59), T189 (= T194), K217 (= K222), A219 (≠ K224), D247 (= D252), N249 (= N254), E273 (= E278), G299 (= G303), E300 (= E304), D323 (= D327), P349 (= P353), H350 (= H354), A351 (= A355), D367 (= D371), K374 (≠ R378), E381 (= E385)
- binding 6-deoxy-L-galactonic acid: G21 (= G27), D23 (= D29), Y31 (= Y37), W193 (= W198), K217 (= K222), D247 (= D252), E300 (= E304), H350 (= H354), G352 (= G356), E381 (= E385)
- binding magnesium ion: D247 (= D252), E273 (= E278), E300 (= E304)
4ip5A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg and d-erythronohydroxamate
58% identity, 95% coverage: 7:427/442 of query aligns to 1:421/421 of 4ip5A
- active site: K217 (= K224), D245 (= D252), N247 (= N254), E271 (= E278), E298 (= E304), D321 (= D327), H348 (= H354), E379 (= E385)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G27), D23 (= D29), Y31 (= Y37), K215 (= K222), K217 (= K224), D245 (= D252), N247 (= N254), E298 (= E304), H348 (= H354)
- binding magnesium ion: D245 (= D252), E271 (= E278), E298 (= E304)
4ip4A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg
58% identity, 95% coverage: 7:427/442 of query aligns to 1:421/421 of 4ip4A
4a35A Crystal structure of human mitochondrial enolase superfamily member 1 (enosf1) (see paper)
49% identity, 97% coverage: 8:435/442 of query aligns to 6:437/441 of 4a35A
- active site: K221 (= K222), K223 (= K224), D251 (= D252), N253 (= N254), E277 (= E278), E306 (= E304), D329 (= D327), H356 (= H354), S380 (≠ R378), E387 (= E385)
- binding magnesium ion: Y188 (= Y189), D251 (= D252), E277 (= E278), E306 (= E304), Y374 (≠ F372)
Q7L5Y1 Mitochondrial enolase superfamily member 1; Antisense RNA to thymidylate synthase; rTS; L-fuconate dehydratase; EC 4.2.1.68 from Homo sapiens (Human) (see 5 papers)
49% identity, 97% coverage: 8:435/442 of query aligns to 5:436/443 of Q7L5Y1
- M145 (≠ Q147) to T: in dbSNP:rs2612086
- S148 (≠ A150) modified: Phosphoserine
- D250 (= D252) binding
- E276 (= E278) binding
- E305 (= E304) binding
Sites not aligning to the query:
- 1:27 mutation Missing: Impairs protein solubility. Abolishes catalytic activity.
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
28% identity, 95% coverage: 7:425/442 of query aligns to 1:367/372 of 4h19A
- active site: I20 (≠ G27), T51 (= T59), T143 (= T194), K172 (= K222), K174 (= K224), D203 (= D252), N205 (= N254), E229 (= E278), G254 (= G303), E255 (= E304), Q276 (= Q325), D278 (= D327), H305 (= H354), A306 (= A355), G307 (= G356), E327 (= E385)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (= D29), H25 (≠ N32), H52 (vs. gap), K172 (= K222), K174 (= K224), D203 (= D252), N205 (= N254), E229 (= E278), E255 (= E304), H305 (= H354), E327 (= E385)
- binding calcium ion: D268 (≠ Q317), H298 (≠ F347)
- binding magnesium ion: D203 (= D252), E229 (= E278), E255 (= E304)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
30% identity, 48% coverage: 215:425/442 of query aligns to 141:348/351 of 5olcC
- active site: K148 (= K222), K150 (= K224), D178 (= D252), N180 (= N254), E204 (= E278), G229 (= G303), E230 (= E304), D253 (= D327), H280 (= H354), E304 (≠ T376), E309 (≠ D381)
- binding magnesium ion: D178 (= D252), E204 (= E278), E230 (= E304)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
34% identity, 49% coverage: 212:429/442 of query aligns to 154:377/378 of 4hpnA
- active site: K164 (= K222), K166 (= K224), D194 (= D252), N196 (= N254), E220 (= E278), G245 (= G303), E246 (= E304), T247 (≠ H305), Q267 (= Q325), D269 (= D327), H296 (= H354), V297 (≠ A355), W298 (≠ G356), R320 (= R382), E329 (= E385), F330 (= F386), H334 (= H391)
- binding calcium ion: D194 (= D252), D209 (≠ R267), E220 (= E278), G237 (≠ A295), E246 (= E304)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 69% coverage: 101:403/442 of query aligns to 113:366/398 of Q8ZL58
- K195 (= K222) binding
- K197 (= K224) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D252) binding
- N228 (= N254) binding
- E252 (= E278) binding
- E278 (= E304) binding
- H328 (= H354) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E385) binding
Sites not aligning to the query:
- 46:48 binding
- 82:83 binding
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
30% identity, 69% coverage: 101:403/442 of query aligns to 110:363/395 of 2pp1A
- active site: K192 (= K222), K194 (= K224), D223 (= D252), N225 (= N254), E249 (= E278), G274 (= G303), E275 (= E304), D298 (= D327), H325 (= H354), E345 (= E385)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: F168 (≠ W198), K194 (= K224), E275 (= E304), H325 (= H354), E345 (= E385)
- binding magnesium ion: D223 (= D252), E249 (= E278), E275 (= E304)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
30% identity, 69% coverage: 101:403/442 of query aligns to 110:363/395 of 2pp3A
- active site: K192 (= K222), A194 (≠ K224), D223 (= D252), N225 (= N254), E249 (= E278), G274 (= G303), E275 (= E304), D298 (= D327), H325 (= H354), E345 (= E385)
- binding l-glucaric acid: K192 (= K222), D223 (= D252), N225 (= N254), E275 (= E304), H325 (= H354), E345 (= E385), F347 (≠ V387)
- binding magnesium ion: D223 (= D252), E249 (= E278), E275 (= E304)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
35% identity, 50% coverage: 191:413/442 of query aligns to 129:341/363 of 2og9A
- active site: T132 (= T194), K160 (= K222), K162 (= K224), D191 (= D252), N193 (= N254), E217 (= E278), G242 (= G303), E243 (= E304), M264 (≠ Q325), D266 (= D327), H293 (= H354), F294 (≠ A355), A295 (≠ G356), E313 (= E385)
- binding calcium ion: A232 (≠ R293), F235 (≠ V296)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
35% identity, 50% coverage: 191:413/442 of query aligns to 140:352/373 of 3cb3A
- active site: T143 (= T194), K171 (= K222), K173 (= K224), D202 (= D252), N204 (= N254), E228 (= E278), G253 (= G303), E254 (= E304), M275 (≠ Q325), D277 (= D327), H304 (= H354), F305 (≠ A355), A306 (≠ G356), E324 (= E385)
- binding l-glucaric acid: K171 (= K222), K173 (= K224), D202 (= D252), E254 (= E304), H304 (= H354)
- binding magnesium ion: D202 (= D252), E228 (= E278), A243 (≠ R293), F246 (≠ V296), E254 (= E304)
Sites not aligning to the query:
2qq6B Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from rubrobacter xylanophilus dsm 9941
28% identity, 74% coverage: 104:430/442 of query aligns to 72:391/396 of 2qq6B
- active site: G79 (≠ P108), D124 (= D153), K166 (= K222), D168 (≠ K224), D213 (= D252), H215 (≠ N254), E239 (= E278), G264 (= G303), E265 (= E304), M286 (≠ Q325), D288 (= D327), H315 (= H354), N316 (vs. gap), E340 (≠ D380), D345 (≠ E385)
- binding magnesium ion: D213 (= D252), E239 (= E278), E265 (= E304), H315 (= H354)
Sites not aligning to the query:
2ggeD Crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
29% identity, 54% coverage: 189:427/442 of query aligns to 129:368/376 of 2ggeD
- active site: K158 (= K222), K160 (= K224), D189 (= D252), N191 (= N254), E216 (= E278), G241 (= G303), E242 (= E304), D265 (= D327), H292 (= H354), N318 (≠ D380), D319 (= D381), E325 (= E385)
- binding magnesium ion: E216 (= E278), E242 (= E304), H292 (= H354)
Sites not aligning to the query:
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
29% identity, 55% coverage: 190:433/442 of query aligns to 132:374/376 of 3bjsB
- active site: G136 (≠ T194), K164 (= K222), R166 (≠ K224), D194 (= D252), N196 (= N254), E220 (= E278), G246 (= G303), E247 (= E304), N248 (≠ H305), Q268 (= Q325), D270 (= D327), H297 (= H354), S298 (≠ A355), S299 (≠ G356), E322 (≠ D381), C324 (≠ A383), K327 (≠ F386)
- binding magnesium ion: D194 (= D252), E220 (= E278), E247 (= E304)
Sites not aligning to the query:
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
33% identity, 45% coverage: 214:412/442 of query aligns to 156:342/357 of 3ck5A
- active site: K164 (= K222), K166 (= K224), D195 (= D252), N197 (= N254), I220 (= I277), E221 (= E278), I243 (≠ V300), G246 (= G303), E247 (= E304), E268 (≠ Q325), D270 (= D327), H297 (= H354), G298 (≠ A355), V299 (= V364), Y315 (≠ D380), E317 (≠ R382)
- binding magnesium ion: D195 (= D252), E221 (= E278), E247 (= E304)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_1251 FitnessBrowser__Dyella79:N515DRAFT_1251
MAKHAPVKITALDTYDIRFPTSRQLDGSDAMNPDPDYSAAYAVLRTDDPALAGYGLAFTI
GRGNDVQKAALDALRPYVVGLTLDEVTNDLGGFAARMVGDSQLRWLGPEKGVMHMAIGAV
INAGWDLAARRAGKPLWRYIAELTPEQLVATIDFRYLSDAITPDEALQMLRAAEPAKSAR
IEQLLAEGYPAYTTSPGWLGYTDEKMLRLAREAVADGFRTIKLKVGLSVEDDVRRCSLVR
QTVGPDVAIAVDANQRWDVHAAIDWLRRLEGFDLAWIEEPTSPDDVLGHAAIRRAVSVPV
STGEHTQNRVIFKQLFQAGAVDLVQIDAARVGGVNENLAILLMAAKFGVRVFPHAGGVGL
CELVQHLAMADFVAITGRKDDRAIEFVDHLHEHFDDPVTIRDGHYLAPTAPGFSARMHES
TLVEYRFPDGPVWSEQTVAALH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory