Comparing N515DRAFT_1323 FitnessBrowser__Dyella79:N515DRAFT_1323 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P0AFF4 Nucleoside permease NupG; Nucleoside-transport system protein NupG from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 1:390/401 of query aligns to 3:406/418 of P0AFF4
2y5yA Crystal structure of lacy in complex with an affinity inactivator (see paper)
26% identity, 63% coverage: 15:265/401 of query aligns to 19:272/386 of 2y5yA
Sites not aligning to the query:
P02920 Lactose permease; Lactose-proton symport from Escherichia coli (strain K12) (see 3 papers)
26% identity, 63% coverage: 15:268/401 of query aligns to 22:292/417 of P02920
Sites not aligning to the query:
4zyrA Crystal structure of e. Coli lactose permease g46w/g262w bound to p- nitrophenyl alpha-d-galactopyranoside (alpha-npg) (see paper)
25% identity, 63% coverage: 15:265/401 of query aligns to 17:268/387 of 4zyrA
Sites not aligning to the query:
6vbgB Lactose permease complex with thiodigalactoside and nanobody 9043 (see paper)
26% identity, 63% coverage: 15:265/401 of query aligns to 22:277/397 of 6vbgB
Sites not aligning to the query:
>N515DRAFT_1323 FitnessBrowser__Dyella79:N515DRAFT_1323
MKWRLRLMMLFEYAIWGAWYVTVGTWLGKTLHFSGQEIGAIAGTTAIGAMISPLFVGLLA
DRLFDTRRVLAALHVLGAVLLMFAARQSSFPLLYGTLLAYSLCYMPTLALTTSLAMRHIR
DPQEEFGGIRVLGTIGWIVVGLIVGAWGVEATATPLQLAAGLSVVTALYCLTLPPTPPLA
RNQRFELRHALPLESLHLLRDRSMAVFALASFLICIPLQFYYAFTNLFLNEVGVVNAAGK
MTGGQMSEILCMLLIPWFFRRLGVKYMLAVGMLAWVLRYVLFAFGAPGDLMWMLWLGIVL
HGICFDFFFVVGQIYIDREAPSALRAATQGLITFLTYGLGMFVGSWLSGVVVDTYAGAQN
AHDWRSIWLIAGGCAAAVLVLFVLAFKDRRSAAGQPVAVTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory