SitesBLAST
Comparing N515DRAFT_1894 FitnessBrowser__Dyella79:N515DRAFT_1894 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
46% identity, 99% coverage: 3:542/543 of query aligns to 2:522/526 of 5khaA
- active site: D291 (= D293), E397 (= E399)
- binding adenosine-5'-diphosphate: Y273 (= Y275), F279 (= F281), N368 (= N370), R372 (= R374), M379 (= M381), S382 (= S384), N383 (= N385), C403 (≠ A405), T404 (= T406), Y494 (≠ F514), K495 (= K515)
2e18A Crystal structure of project ph0182 from pyrococcus horikoshii ot3
37% identity, 47% coverage: 265:517/543 of query aligns to 6:243/256 of 2e18A
Sites not aligning to the query:
P9WJJ3 Glutamine-dependent NAD(+) synthetase; NAD(+) synthase [glutamine-hydrolyzing]; EC 6.3.5.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:519/679 of P9WJJ3
- E52 (= E44) mutation to A: Lack of glutamine-dependent activity. Retains 30% of ammonia-dependent activity.
- K121 (= K110) mutation to A: Lack of glutamine-dependent and ammonia-dependent activities.
- C176 (= C146) mutation to A: Lack of glutamine-dependent activity. Retains 90% of ammonia-dependent activity.
Sites not aligning to the query:
- 656 D→A: Causes a decrease in ammonia channel efficiency to 70% compared with wild-type enzyme.
3sytA Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:513/660 of 3sytA
- binding adenosine monophosphate: G366 (= G287), V367 (≠ L288), S368 (= S289), S373 (= S294), L399 (≠ M315), R456 (= R376), T474 (= T394)
- binding glutamic acid: Y127 (= Y116), F180 (≠ W150), S203 (= S172), R209 (≠ K178)
- binding nicotinamide-adenine-dinucleotide: R354 (≠ Y275), L358 (≠ N279), N450 (= N370), N465 (= N385), G469 (≠ R389), E479 (= E399), W484 (≠ Y404), S485 (≠ A405), T486 (= T406), Y487 (≠ L407), D491 (= D410), H495 (≠ A414)
- binding pyrophosphate 2-: S368 (= S289), G370 (= G291), L371 (≠ I292), D372 (= D293), S373 (= S294)
Sites not aligning to the query:
6ofcC Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:515/665 of 6ofcC
- binding glutamine: Y58 (= Y50), K121 (= K110), P125 (= P114), F130 (= F119), A176 (≠ C146), E177 (= E147), F180 (≠ W150)
- binding 5'-O-[(pyridine-3-carbonyl)sulfamoyl]adenosine: R354 (≠ Y275), L358 (≠ N279), G366 (= G287), V367 (≠ L288), S368 (= S289), S373 (= S294), F397 (≠ V313), A398 (≠ M314), L399 (≠ M315), R458 (= R376), N467 (= N385), G471 (≠ R389), T476 (= T394), W486 (≠ Y404), S487 (≠ A405), T488 (= T406), Y489 (≠ L407), H497 (≠ A414)
Sites not aligning to the query:
3dlaA X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 13:506/651 of 3dlaA
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y275), L359 (≠ N279), G462 (≠ R389), E472 (= E399), W477 (≠ Y404), S478 (≠ A405), T479 (= T406), Y480 (≠ L407), D484 (= D410), H488 (≠ A414)
- binding 5-oxo-l-norleucine: Y128 (= Y116), F131 (= F119), C177 (= C146), E178 (= E147), F181 (≠ W150)
Sites not aligning to the query:
6ofcB Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:509/669 of 6ofcB
- binding pyrophosphate 2-: S368 (= S289), G370 (= G291), S373 (= S294)
- binding 5'-O-[(pyridine-3-carbonyl)sulfamoyl]adenosine: R354 (≠ Y275), L358 (≠ N279), G366 (= G287), V367 (≠ L288), S368 (= S289), A398 (≠ M314), L399 (≠ M315), R452 (= R376), G465 (≠ R389), I466 (≠ L390), T470 (= T394), W480 (≠ Y404), S481 (≠ A405), T482 (= T406), T482 (= T406), Y483 (≠ L407), D487 (= D410), H491 (≠ A414)
Sites not aligning to the query:
3seqA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 13:514/661 of 3seqA
- binding diphosphomethylphosphonic acid adenosyl ester: G367 (= G287), V368 (≠ L288), S369 (= S289), G371 (= G291), L372 (≠ I292), D373 (= D293), S374 (= S294), L400 (≠ M315), R457 (= R376), T475 (= T394)
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y275), L359 (≠ N279), V447 (≠ L366), N466 (= N385), G470 (≠ R389), E480 (= E399), W485 (≠ Y404), T487 (= T406), Y488 (≠ L407), D492 (= D410), H496 (≠ A414)
Sites not aligning to the query:
3sezA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:513/658 of 3sezA
- binding adenosine-5'-triphosphate: G366 (= G287), V367 (≠ L288), S368 (= S289), S373 (= S294), A398 (≠ M314), L399 (≠ M315), R456 (= R376), T474 (= T394)
- binding nicotinic acid adenine dinucleotide: R354 (≠ Y275), L358 (≠ N279), N465 (= N385), G469 (≠ R389), E479 (= E399), W484 (≠ Y404), S485 (≠ A405), T486 (= T406), Y487 (≠ L407), D491 (= D410), H495 (≠ A414)
Sites not aligning to the query:
3sytD Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:503/649 of 3sytD
- binding adenosine monophosphate: G366 (= G287), V367 (≠ L288), S368 (= S289), A398 (≠ M314), L399 (≠ M315), R446 (= R376)
- binding glutamic acid: Y127 (= Y116), E177 (= E147), F180 (≠ W150), S203 (= S172)
- binding nicotinamide-adenine-dinucleotide: R354 (≠ Y275), L358 (≠ N279), N455 (= N385), G459 (≠ R389), E469 (= E399), W474 (≠ Y404), T476 (= T406), Y477 (≠ L407), D481 (= D410), H485 (≠ A414)
- binding pyrophosphate 2-: S368 (= S289), G370 (= G291), L371 (≠ I292), D372 (= D293), S373 (= S294)
Sites not aligning to the query:
3dlaB X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:502/649 of 3dlaB
- binding nicotinic acid adenine dinucleotide: L358 (≠ N279), G458 (≠ R389), W473 (≠ Y404), S474 (≠ A405), T475 (= T406), D480 (= D410), H484 (≠ A414)
- binding 5-oxo-l-norleucine: C176 (= C146), F180 (≠ W150), S201 (≠ N170), S203 (= S172), R209 (≠ K178), Y230 (≠ N201)
Sites not aligning to the query:
3seqD Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 13:504/650 of 3seqD
- binding diphosphomethylphosphonic acid adenosyl ester: G367 (= G287), V368 (≠ L288), S369 (= S289), G371 (= G291), L372 (≠ I292), D373 (= D293), S374 (= S294), A399 (≠ M314), L400 (≠ M315), R447 (= R376), T465 (= T394)
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y275), L359 (≠ N279), N456 (= N385), G460 (≠ R389), W475 (≠ Y404), S476 (≠ A405), T477 (= T406), Y478 (≠ L407), D482 (= D410), H486 (≠ A414)
Sites not aligning to the query:
3sezC Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
27% identity, 79% coverage: 4:432/543 of query aligns to 12:502/648 of 3sezC
- binding adenosine-5'-triphosphate: G366 (= G287), V367 (≠ L288), S368 (= S289), S373 (= S294), A398 (≠ M314), L399 (≠ M315), R445 (= R376), T463 (= T394)
- binding nicotinic acid adenine dinucleotide: L358 (≠ N279), N454 (= N385), G458 (≠ R389), E468 (= E399), W473 (≠ Y404), S474 (≠ A405), T475 (= T406), Y476 (≠ L407), D480 (= D410), H484 (≠ A414)
Sites not aligning to the query:
O25096 NH(3)-dependent NAD(+) synthetase; EC 6.3.1.5 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
31% identity, 50% coverage: 255:526/543 of query aligns to 1:258/260 of O25096
- 31:38 (vs. 287:294, 88% identical) binding
- T132 (= T394) binding
- K161 (= K423) binding
1xngB Crystal structure of nh3-dependent NAD+ synthetase from helicobacter pylori (see paper)
31% identity, 48% coverage: 265:526/543 of query aligns to 3:256/262 of 1xngB
- active site: D35 (= D293), E135 (= E399)
- binding adenosine-5'-triphosphate: G29 (= G287), L30 (= L288), S31 (= S289), G33 (= G291), L34 (≠ I292), D35 (= D293), S36 (= S294), M56 (= M315), R112 (= R376), T130 (= T394), E135 (= E399), K159 (= K423), S181 (= S456)
- binding nicotinic acid adenine dinucleotide: R21 (vs. gap), F23 (= F281), N106 (= N370), Y117 (≠ M381), S120 (= S384), L121 (≠ N385), L126 (= L390), Y140 (= Y404), G141 (≠ A405), T142 (= T406), D146 (= D410), A150 (= A414), A182 (= A457), F244 (= F514), K245 (= K515)
3fiuA Structure of nmn synthetase from francisella tularensis (see paper)
31% identity, 38% coverage: 283:491/543 of query aligns to 26:214/238 of 3fiuA
- binding adenosine monophosphate: G30 (= G287), L31 (= L288), S32 (= S289), L56 (≠ M315), R113 (= R376), T131 (= T394), D147 (= D410), S182 (= S456)
- binding magnesium ion: D36 (= D293), E136 (= E399)
- binding pyrophosphate 2-: S32 (= S289), G34 (= G291), I35 (= I292), D36 (= D293), S37 (= S294), K160 (= K423), P181 (= P455), S182 (= S456)
Q9VYA0 Glutamine-dependent NAD(+) synthetase; NAD(+) synthase [glutamine-hydrolyzing]; EC 6.3.5.1 from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 84% coverage: 21:476/543 of query aligns to 22:591/787 of Q9VYA0
Sites not aligning to the query:
- 703 modified: Phosphoserine
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
30% identity, 46% coverage: 4:252/543 of query aligns to 2:253/254 of 4izuA
- binding prop-2-enamide: Q17 (≠ A19), A65 (≠ C65), R68 (≠ E68)
- binding propionamide: Q42 (≠ E44), Y48 (= Y50), C54 (≠ L56), P90 (vs. gap), E91 (= E91), K112 (≠ A112), Y116 (= Y116), C146 (= C146), Y147 (≠ E147)
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
32% identity, 41% coverage: 2:222/543 of query aligns to 8:228/263 of 4iztA
2nsyA Crystal structure of nh3-dependent NAD+ synthetase from bacillus subtilis in complex with NAD-adenylate (see paper)
26% identity, 41% coverage: 269:493/543 of query aligns to 26:245/271 of 2nsyA
- active site: D50 (= D293), E162 (= E399)
- binding adenosine monophosphate: G44 (= G287), I45 (≠ L288), S46 (= S289), S51 (= S294), R78 (≠ M314), L79 (≠ M315), Q84 (= Q322), R139 (= R376), T157 (= T394), D173 (= D410), T208 (≠ S456), A209 (= A457)
- binding magnesium ion: D50 (= D293), E162 (= E399)
- binding nicotinamide-adenine-dinucleotide: Y32 (= Y275), F129 (≠ L366), N133 (= N370), Y144 (≠ M381), L153 (= L390), F167 (≠ Y404), F168 (≠ A405), T169 (= T406), K170 (≠ L407), D173 (= D410), D177 (≠ A414), A209 (= A457), L211 (= L459), E223 (≠ S468)
- binding pyrophosphate 2-: S46 (= S289), G48 (= G291), D50 (= D293), S51 (= S294), K186 (= K423), P207 (= P455), T208 (≠ S456)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_1894 FitnessBrowser__Dyella79:N515DRAFT_1894
MTTLRLALAQFDFPVGAVAANAARVGDLLAQARDGGADLVVYPELTLSGYPPEDLLLRPS
FLAACDSELSALAAATNGVAALVGHPHSEGEVYNAASLLRQGRVELTAHKQALPNYGVFD
DKRYFRPGHETAVATIEGVTVGLLICEDVWQPEPAAQAARAGAELIVVINASPWDGAKQA
EREAVLRARAQETGCALIYLNLVGGQDEVVYDGGSLLVNGDGSVAARAPAFVEALLWADF
DAATRTLLADAWPAMQDDAPEATLYAALVRGIRDYIEKNGFGGVLLGLSGGIDSALTLAL
AVDALGPQRVTAVMMPSRYTSQLSLDGARAQAEQLGVEYHIISIEQTFQSFIEALTPAFA
GKPADLTEENLQSRTRGAMLMALSNKHGRLLLATGNKSEMAVGYATLYGDMCGAYAPLKD
VYKTVVYRLSRWRNAHAERFGGGEVIPPAVIERPPSAELRDNQTDQDSLPPYDELDAILE
RFIEGEQSQAEIAAQGFHCDTVRRVVRLVLLNEFKRRQSAPGPRVTTRAFGRERRYPITS
GWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory