Comparing N515DRAFT_2551 FitnessBrowser__Dyella79:N515DRAFT_2551 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00080 Cytochrome c2 from Rhodopila globiformis (Rhodopseudomonas globiformis) (see paper)
48% identity, 92% coverage: 9:110/111 of query aligns to 6:105/106 of P00080
P00047 Cytochrome c from Thermomyces lanuginosus (Humicola lanuginosa) (see paper)
47% identity, 89% coverage: 9:107/111 of query aligns to 9:106/111 of P00047
P00076 Cytochrome c from Euglena gracilis (see paper)
46% identity, 92% coverage: 9:110/111 of query aligns to 1:100/102 of P00076
1hroA Molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis (see paper)
47% identity, 92% coverage: 9:110/111 of query aligns to 5:104/105 of 1hroA
2yk3A Crithidia fasciculata cytochromE C (see paper)
44% identity, 96% coverage: 4:110/111 of query aligns to 3:108/110 of 2yk3A
P00078 Cytochrome c; Cytochrome c555 from Crithidia fasciculata (see paper)
44% identity, 96% coverage: 4:110/111 of query aligns to 7:112/114 of P00078
Sites not aligning to the query:
P00077 Cytochrome c; Cytochrome c557 from Strigomonas oncopelti (Parasitic flagellate) (Crithidia oncopelti) (see 2 papers)
46% identity, 95% coverage: 5:110/111 of query aligns to 8:112/113 of P00077
Sites not aligning to the query:
P00038 Cytochrome c from Apis mellifera (Honeybee) (see paper)
44% identity, 90% coverage: 8:107/111 of query aligns to 5:103/108 of P00038
Sites not aligning to the query:
4dy9A Leishmania major peroxidase is a cytochromE C peroxidase (see paper)
44% identity, 96% coverage: 4:110/111 of query aligns to 2:107/108 of 4dy9A
4gedB Crystal structure of the leishmania major peroxidase-cytochromE C complex (see paper)
45% identity, 92% coverage: 9:110/111 of query aligns to 1:101/102 of 4gedB
P00069 Cytochrome c from Guizotia abyssinica (Niger) (Ramtilla)
44% identity, 90% coverage: 8:107/111 of query aligns to 8:106/111 of P00069
Sites not aligning to the query:
P00015 Cytochrome c, testis-specific from Mus musculus (Mouse) (see paper)
42% identity, 89% coverage: 9:107/111 of query aligns to 2:99/105 of P00015
Sites not aligning to the query:
2aiuA Crystal structure of mouse testicular cytochromE C at 1.6 angstrom (see paper)
42% identity, 89% coverage: 9:107/111 of query aligns to 1:98/104 of 2aiuA
P00048 Cytochrome c from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 5 papers)
43% identity, 90% coverage: 8:107/111 of query aligns to 5:103/108 of P00048
Sites not aligning to the query:
P22342 Cytochrome c from Euglena viridis (Cercaria viridis) (see paper)
43% identity, 92% coverage: 9:110/111 of query aligns to 1:100/102 of P22342
P00074 Cytochrome c from Ginkgo biloba (Ginkgo) (Maidenhair tree) (see paper)
42% identity, 95% coverage: 2:107/111 of query aligns to 2:106/113 of P00074
Sites not aligning to the query:
Q0DI31 Cytochrome c from Oryza sativa subsp. japonica (Rice) (see paper)
43% identity, 94% coverage: 4:107/111 of query aligns to 5:107/112 of Q0DI31
Sites not aligning to the query:
P00049 Cytochrome c from Ustilago sphaerogena (Smut fungus) (see paper)
43% identity, 89% coverage: 9:107/111 of query aligns to 5:102/107 of P00049
P00066 Cytochrome c from Nigella damascena (Love-in-a-mist) (see paper)
40% identity, 90% coverage: 8:107/111 of query aligns to 8:106/111 of P00066
Sites not aligning to the query:
1ccrA Structure of rice ferricytochromE C at 2.0 angstroms resolution (see paper)
43% identity, 94% coverage: 4:107/111 of query aligns to 4:106/111 of 1ccrA
>N515DRAFT_2551 FitnessBrowser__Dyella79:N515DRAFT_2551
MTASPAFAGDASAGSDVFKSECAECHSIKEGRNKKGPSLFGVVGRKAAAVPDYEYSDALR
AQSAWVWTPEQLHSYLGQPAKRANPGTKMKYDGLNDPKQLDDLISYLGTLH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory