Comparing N515DRAFT_2628 FitnessBrowser__Dyella79:N515DRAFT_2628 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P25026 Non-heme chloroperoxidase; Chloride peroxidase; Chloroperoxidase P; CPO-P; EC 1.11.1.- from Burkholderia pyrrocinia (Pseudomonas pyrrocinia) (see paper)
69% identity, 98% coverage: 5:274/275 of query aligns to 4:277/278 of P25026
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
49% identity, 99% coverage: 3:274/275 of query aligns to 1:270/271 of 3heaA
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
49% identity, 99% coverage: 3:274/275 of query aligns to 1:270/271 of 3hi4A
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
48% identity, 99% coverage: 3:274/275 of query aligns to 2:271/272 of P22862
Sites not aligning to the query:
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
48% identity, 99% coverage: 3:274/275 of query aligns to 1:270/271 of 3ia2A
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
49% identity, 98% coverage: 5:274/275 of query aligns to 3:270/276 of 8pi1B
Sites not aligning to the query:
1hl7A Gamma lactamase from an aureobacterium species in complex with 3a,4,7, 7a-tetrahydro-benzo [1,3] dioxol-2-one (see paper)
37% identity, 96% coverage: 11:273/275 of query aligns to 13:277/279 of 1hl7A
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
27% identity, 100% coverage: 1:274/275 of query aligns to 1:267/269 of 5h3hB
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
25% identity, 92% coverage: 9:260/275 of query aligns to 7:250/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
25% identity, 92% coverage: 9:260/275 of query aligns to 7:247/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
25% identity, 92% coverage: 9:260/275 of query aligns to 7:244/262 of 6eb3C
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
38% identity, 41% coverage: 7:120/275 of query aligns to 11:123/272 of 4uheA
Sites not aligning to the query:
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
38% identity, 41% coverage: 7:120/275 of query aligns to 11:123/274 of 4uhdA
Sites not aligning to the query:
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
38% identity, 41% coverage: 7:120/275 of query aligns to 11:123/278 of 4uhfA
Sites not aligning to the query:
5aljA Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 51% coverage: 5:143/275 of query aligns to 228:362/523 of 5aljA
Sites not aligning to the query:
7p4kA Soluble epoxide hydrolase in complex with fl217 (see paper)
28% identity, 51% coverage: 5:143/275 of query aligns to 14:148/313 of 7p4kA
Sites not aligning to the query:
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
26% identity, 98% coverage: 4:272/275 of query aligns to 7:268/276 of 1iunB
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
25% identity, 98% coverage: 4:272/275 of query aligns to 6:267/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
25% identity, 98% coverage: 4:272/275 of query aligns to 6:267/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
25% identity, 98% coverage: 4:272/275 of query aligns to 6:267/271 of 1uk8A
>N515DRAFT_2628 FitnessBrowser__Dyella79:N515DRAFT_2628
MTNKIVTKDGVEIFYKDWGKGQPVVFSHGWPLSSDDWDAQMLFFLDHGYRVIAHDRRGHG
RSTQTDTGNDMEHYAADLAALTEALDLRDAIHIGHSTGGGEVAAYVARHGQKRTAKIVLI
GAVPPIMVKNANNPGGTPIEVFDDFRKQLVANRAQFFLDIPTGPFYGFNRPGAKLSEGIV
RNWWRQGMMGGTKAHYDCIKAFSETDFTEDLKKIEQPALVLHGDDDQVVPYQDAGVLSAK
LLKNATLKIYPGFPHGMATTHADVINNDILAFIKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory