Comparing N515DRAFT_3479 FitnessBrowser__Dyella79:N515DRAFT_3479 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
41% identity, 89% coverage: 10:196/210 of query aligns to 11:197/201 of 3m3mA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
38% identity, 92% coverage: 2:194/210 of query aligns to 2:194/206 of 4hz2B
4ecjA Crystal structure of glutathione s-transferase prk13972 (target efi- 501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
36% identity, 92% coverage: 1:193/210 of query aligns to 2:193/204 of 4ecjA
6tahB Glutathione S-transferase
35% identity, 92% coverage: 1:193/210 of query aligns to 3:194/213 of 6tahB
Sites not aligning to the query:
3gx0A Crystal structure of gsh-dependent disulfide bond oxidoreductase (see paper)
32% identity, 92% coverage: 1:193/210 of query aligns to 1:197/204 of 3gx0A
P77526 Disulfide-bond oxidoreductase YfcG; GSH-dependent disulfide-bond oxidoreductase YfcG; GST N1-1; GST-like protein YfcG; Organic hydroperoxidase; EC 1.8.4.-; EC 1.11.1.- from Escherichia coli (strain K12) (see 2 papers)
32% identity, 92% coverage: 1:193/210 of query aligns to 1:197/215 of P77526
4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
29% identity, 90% coverage: 7:194/210 of query aligns to 5:197/203 of 4l8eA
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
36% identity, 90% coverage: 1:188/210 of query aligns to 1:174/183 of 8ai8A
7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
36% identity, 90% coverage: 1:188/210 of query aligns to 1:174/183 of 7pkaA
5hfkA Crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. Sakai (ecs3186, target efi-507414) with bound glutathione
32% identity, 92% coverage: 1:193/210 of query aligns to 1:197/207 of 5hfkA
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
33% identity, 89% coverage: 8:193/210 of query aligns to 38:234/246 of 4nhzH
4e8hB Structural of bombyx mori glutathione transferase bmgstd1 complex with gtt
31% identity, 90% coverage: 2:190/210 of query aligns to 7:193/216 of 4e8hB
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
34% identity, 78% coverage: 32:194/210 of query aligns to 31:192/207 of 1jlvA
Sites not aligning to the query:
4f0cA Crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium (see paper)
28% identity, 80% coverage: 2:169/210 of query aligns to 6:179/228 of 4f0cA
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
33% identity, 76% coverage: 37:195/210 of query aligns to 38:195/214 of 3wywB
Sites not aligning to the query:
4mzwA Crystal structure of nu-class glutathione transferase yghu from streptococcus sanguinis sk36, complex with glutathione disulfide, target efi-507286
28% identity, 89% coverage: 8:193/210 of query aligns to 55:256/270 of 4mzwA
Sites not aligning to the query:
4f0bA Crystal structure of the glutathione transferase ure2p1 from phanerochaete chrysosporium. (see paper)
30% identity, 88% coverage: 9:193/210 of query aligns to 11:210/220 of 4f0bA
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
28% identity, 92% coverage: 1:194/210 of query aligns to 1:203/213 of 5f06A
5echB Crystal structure of fin219-fip1 complex with ja and atp (see paper)
26% identity, 78% coverage: 4:167/210 of query aligns to 4:159/214 of 5echB
Q8L7C9 Glutathione S-transferase U20; AtGSTU20; FIN219-interacting protein 1; GST class-tau member 20; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 78% coverage: 4:167/210 of query aligns to 7:162/217 of Q8L7C9
>N515DRAFT_3479 FitnessBrowser__Dyella79:N515DRAFT_3479
MLTLYDYLPSQNGWKVRQLLRHLDLPYRTVPVSIFEGEGRQPGYLRINPTGTVPAIALED
GRTLAESNAILAYLAEGTPYLPGDAYGRAKVLQWLNFEQERVESVIGSLRYWTLTGQLAK
RGPALVELKREAGLRALSMLDAELGTRPFVASESYGIADIALFAYASRADEAGFDLAPYS
HFQAWIERVRAQPGHLAKTFPYSVDPHAPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory