Comparing N515DRAFT_3778 FitnessBrowser__Dyella79:N515DRAFT_3778 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
50% identity, 99% coverage: 2:334/337 of query aligns to 1:335/336 of Q8TDX5
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
50% identity, 99% coverage: 2:334/337 of query aligns to 1:335/335 of 4ofcA
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
51% identity, 99% coverage: 3:334/337 of query aligns to 1:334/334 of 7pwyA
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
51% identity, 97% coverage: 2:329/337 of query aligns to 1:330/332 of 4ih3A
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
51% identity, 97% coverage: 2:329/337 of query aligns to 1:330/332 of 2wm1A
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
47% identity, 97% coverage: 3:329/337 of query aligns to 1:300/301 of 7pwyC
7k13C Acmsd in complex with diflunisal derivative 14 (see paper)
39% identity, 97% coverage: 3:329/337 of query aligns to 3:330/331 of 7k13C
7k12A Acmsd in complex with diflunisal (see paper)
39% identity, 97% coverage: 3:329/337 of query aligns to 3:330/331 of 7k12A
2hbvA Crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd) (see paper)
39% identity, 97% coverage: 3:329/337 of query aligns to 3:330/331 of 2hbvA
4ergA Evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase (see paper)
38% identity, 97% coverage: 3:329/337 of query aligns to 3:330/332 of 4ergA
4eraA Evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase (see paper)
38% identity, 97% coverage: 3:329/337 of query aligns to 3:330/332 of 4eraA
4ni8A Crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis complexed with mn and 5-methoxyisophtalic acid
33% identity, 64% coverage: 79:294/337 of query aligns to 73:300/335 of 4ni8A
Sites not aligning to the query:
4ng3A Crystal structure of 5-carboxyvanillate decarboxylase from sphingomonas paucimobilis complexed with 4-hydroxy-3-methoxy-5- nitrobenzoic acid
33% identity, 64% coverage: 79:294/337 of query aligns to 73:300/335 of 4ng3A
Sites not aligning to the query:
4l6dA Crystal structure of 5-carboxyvanillate decarboxylase from sphingomonas paucimobilis complexed with vanillic acid
33% identity, 64% coverage: 79:294/337 of query aligns to 73:300/335 of 4l6dA
Sites not aligning to the query:
4icmA Crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis
33% identity, 64% coverage: 79:294/337 of query aligns to 73:300/335 of 4icmA
Sites not aligning to the query:
Q12BV1 Gamma-resorcylate decarboxylase; Gamma-RSD; 2,6-dihydroxybenzoate decarboxylase; 2,6-DHBD; EC 4.1.1.103 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
27% identity, 76% coverage: 67:323/337 of query aligns to 51:318/326 of Q12BV1
Sites not aligning to the query:
4hk5D Crystal structure of cordyceps militaris idcase in apo form (see paper)
28% identity, 68% coverage: 67:294/337 of query aligns to 84:322/380 of 4hk5D
Sites not aligning to the query:
4qroA Crystal structure of dihydroxybenzoic acid decarbboxylase bpro_2061 (target efi-500288) from polaromonas sp. Js666 with bound manganese and an inhibitor, 2-nitroresorcinol
27% identity, 76% coverage: 67:323/337 of query aligns to 51:318/332 of 4qroA
Sites not aligning to the query:
4hk7A Crystal structure of cordyceps militaris idcase in complex with uracil (see paper)
28% identity, 68% coverage: 67:294/337 of query aligns to 83:321/379 of 4hk7A
Sites not aligning to the query:
4hk6A Crystal structure of cordyceps militaris idcase in complex with 5- nitro-uracil (see paper)
28% identity, 68% coverage: 67:294/337 of query aligns to 83:321/369 of 4hk6A
Sites not aligning to the query:
>N515DRAFT_3778 FitnessBrowser__Dyella79:N515DRAFT_3778
MLKIDTHAHVLPRDWPNLAAKFDDLRFPVMTHHDGKHRIYKDGKFFREVWESAFDPQHRI
DDYARFGVAVQVVSTVPVLFSYWAPGYQALELHRHLNDHVAGLCRDYPRHYAGIATVPLQ
SPDLAIRELERCIDELGLHGVQVGSHCNDWNLDAPELFPFFEAAADLGAAVMVHPWDMMG
AASMPKYWLPWLVGMPAEQSRAGCCLVFGGVLERLPRLRVMLAHGGGSFPWSIGRIEHGF
RMRPDLVATDNPRNPREYLKRLYFDSCVHDPQALRYLLDVTGVERVMLGTDYPFPLGEQH
PGSGIEALGLEEAARARLFHGTALEWLGLPLYRFASD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory