SitesBLAST
Comparing N515DRAFT_4364 FitnessBrowser__Dyella79:N515DRAFT_4364 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 94% coverage: 23:361/362 of query aligns to 559:908/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
38% identity, 93% coverage: 24:361/362 of query aligns to 8:355/359 of P31116
- 11:18 (vs. 27:34, 63% identical) binding
- T93 (= T105) binding
- K117 (= K129) binding
- E208 (= E216) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D227) mutation to L: Reduces kcat 150-fold.
- K223 (= K231) mutation to V: Loss of activity.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
38% identity, 93% coverage: 24:361/362 of query aligns to 7:354/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
38% identity, 93% coverage: 24:361/362 of query aligns to 7:354/358 of 1q7gA
- active site: D218 (= D227), K222 (= K231)
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: G13 (= G30), V14 (= V31), V15 (= V32), E39 (≠ N55), N91 (≠ A104), T92 (= T105), S93 (≠ A106), I97 (≠ L110), P114 (≠ A127), K116 (= K129), A143 (= A156), S173 (= S186), K222 (= K231), A338 (= A345), T343 (= T350)
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
38% identity, 93% coverage: 24:361/362 of query aligns to 7:354/358 of 1ebuD
- active site: D218 (= D227), K222 (= K231)
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: G11 (= G28), A12 (≠ T29), G13 (= G30), V14 (= V31), V15 (= V32), E39 (≠ N55), A40 (≠ S56), N91 (≠ A104), S93 (≠ A106), K116 (= K129), T343 (= T350)
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
38% identity, 93% coverage: 24:361/362 of query aligns to 7:354/358 of 1ebfA
- active site: D218 (= D227), K222 (= K231)
- binding nicotinamide-adenine-dinucleotide: I10 (≠ F27), A12 (≠ T29), G13 (= G30), V14 (= V31), V15 (= V32), E39 (≠ N55), A40 (≠ S56), T92 (= T105), S93 (≠ A106), P114 (≠ A127)
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 95% coverage: 17:361/362 of query aligns to 3:364/376 of O94671
- S201 (≠ P201) modified: Phosphoserine
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
29% identity, 83% coverage: 24:322/362 of query aligns to 6:270/331 of 6a0sA
- active site: D191 (= D227), K195 (= K231)
- binding l-homoserine: K99 (= K129), N150 (≠ S186), G151 (= G187), T152 (≠ S188), Y178 (= Y214), E180 (= E216), D186 (= D222), K195 (= K231)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ T29), G12 (= G30), T13 (≠ V31), V14 (= V32), L42 (vs. gap), V43 (vs. gap), R44 (= R72), D45 (≠ E73), K48 (= K76), R50 (≠ H78), A73 (= A104), M74 (≠ T105), A97 (= A127), K99 (= K129), G177 (= G213), E180 (= E216)
Sites not aligning to the query:
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
29% identity, 83% coverage: 24:322/362 of query aligns to 6:270/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
29% identity, 83% coverage: 24:322/362 of query aligns to 6:270/332 of 6a0tB
- active site: D191 (= D227), K195 (= K231)
- binding l-homoserine: N150 (≠ S186), G151 (= G187), T152 (≠ S188), Y178 (= Y214), E180 (= E216), D186 (= D222), K195 (= K231)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G28), G11 (≠ T29), G12 (= G30), T13 (≠ V31), V14 (= V32), L42 (vs. gap), V43 (vs. gap), R44 (= R72), D45 (≠ E73), K48 (= K76), R50 (≠ H78), A73 (= A104), M74 (≠ T105), G75 (≠ A106), A97 (= A127), N98 (= N128), G177 (= G213), E180 (= E216)
Sites not aligning to the query:
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
24% identity, 93% coverage: 24:361/362 of query aligns to 3:297/302 of 5x9dA
- active site: D196 (= D227), K200 (= K231)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (= F27), G7 (= G28), Y8 (≠ T29), G9 (= G30), N10 (≠ V31), V11 (= V32), T37 (≠ S56), R38 (= R57), V72 (vs. gap), S73 (≠ A104), S74 (≠ T105), P82 (vs. gap), T100 (≠ A127), N101 (= N128), K102 (= K129), G127 (≠ A156), S131 (≠ A160), N155 (≠ S186), G156 (= G187), T157 (≠ S188), Y183 (= Y214), A184 (≠ T215), E185 (= E216), D191 (= D222), D196 (= D227), K200 (= K231), A281 (= A345), G282 (= G346), A286 (≠ T350)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
24% identity, 93% coverage: 24:361/362 of query aligns to 3:295/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (= F27), G7 (= G28), Y8 (≠ T29), G9 (= G30), N10 (≠ V31), V11 (= V32), T37 (≠ S56), R38 (= R57), R39 (= R58), V72 (vs. gap), S73 (≠ A104), S74 (≠ T105), T100 (≠ A127), K102 (= K129), G127 (≠ A156), S131 (≠ A160), E185 (= E216), G280 (= G346), A284 (≠ T350)
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
33% identity, 67% coverage: 118:359/362 of query aligns to 93:319/431 of 6dzsA
Sites not aligning to the query:
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 15, 45, 46, 47, 52, 63, 78, 79, 84
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
26% identity, 59% coverage: 24:236/362 of query aligns to 5:218/319 of 3ingA
- active site: D209 (= D227), K213 (= K231)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G28), T10 (= T29), G11 (= G30), N12 (≠ V31), V13 (= V32), D38 (≠ N55), S39 (= S56), K57 (≠ L75), C85 (≠ A104), T86 (= T105), P87 (≠ A106), A112 (= A127), N113 (= N128), K114 (= K129), A139 (= A156), E198 (= E216), S199 (≠ P217)
Sites not aligning to the query:
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
26% identity, 67% coverage: 118:359/362 of query aligns to 93:314/435 of Q5F8J4
Sites not aligning to the query:
- 45 L→R: Shows a marked increase in the catalytic efficiency with NADP(+).
- 45:46 LS→RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; LS→RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
30% identity, 33% coverage: 115:234/362 of query aligns to 88:197/402 of 4pg7A
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
24% identity, 59% coverage: 26:238/362 of query aligns to 8:223/321 of 3jsaA
- active site: D212 (= D227), K216 (= K231)
- binding nicotinamide-adenine-dinucleotide: G10 (= G28), L11 (≠ T29), G12 (= G30), N13 (≠ V31), V14 (= V32), D42 (≠ N55), S43 (= S56), A90 (= A104), T91 (= T105), P92 (vs. gap), A117 (= A127), N118 (= N128), A144 (= A156)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_4364 FitnessBrowser__Dyella79:N515DRAFT_4364
MSAVLAEADVQTAGANAAASGTAIVLFGTGVVGGALLKLLNTPAAASLRLVGAANSRRQQ
TSAEQLADRALREKLKSHGDPRDDATLLRALDTSGAAVKVIIDATANANLAARHADWLAR
GYHVVTANKALAGGELPGWRALQAAVAQGGRYGDAATVGAGLPVLSTLRRLRACGDALLT
LEGVFSGSLSYLFNQYDGSQPFSGLLREARKLGYTEPDPRSDLSGEDVARKLLIIARNAG
FALGTDEVEVESLVPEALRSVDTDSFLARLEELDEPLARRHAEAKARGGVLRFLARLNQR
GKARVGLVEVPATHPAARLYGTDNQFALTTTRYHSQPLVIQGPGAGPEVTAQALLGDVLA
LT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory