SitesBLAST
Comparing N515DRAFT_4366 FitnessBrowser__Dyella79:N515DRAFT_4366 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
23% identity, 77% coverage: 2:427/554 of query aligns to 16:423/456 of 5oqtA
- binding alanine: I38 (≠ S23), G40 (≠ I25), T41 (≠ G26), G42 (≠ S27), F226 (= F221), A227 (≠ S222), I229 (≠ N224)
- binding : E24 (≠ D10), G26 (= G12), F28 (= F14), D29 (≠ A15), M32 (= M17), A176 (vs. gap), R177 (≠ L161), A184 (= A168), A188 (≠ F172), L192 (≠ V176), Q294 (≠ L297), V297 (≠ L300)
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
23% identity, 77% coverage: 2:427/554 of query aligns to 18:425/458 of 6f34A
- binding arginine: I40 (≠ S23), G42 (≠ I25), T43 (≠ G26), G44 (≠ S27), E115 (≠ V105), Y116 (≠ E106), A119 (= A109), F228 (= F221), A229 (≠ S222), I231 (≠ N224), V314 (≠ T315)
- binding cholesterol: W201 (≠ A183), Y202 (≠ L184)
- binding : G28 (= G12), F30 (= F14), D31 (≠ A15), M34 (= M17), A178 (vs. gap), R179 (≠ L161), A186 (= A168), I187 (= I169), A190 (≠ F172), L194 (≠ V176), Q296 (≠ L297), V299 (≠ L300)
6f2wA Bacterial asc transporter crystal structure in open to in conformation (see paper)
26% identity, 81% coverage: 9:457/554 of query aligns to 2:432/433 of 6f2wA
Q01650 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter from Homo sapiens (Human) (see 3 papers)
25% identity, 78% coverage: 21:451/554 of query aligns to 60:474/507 of Q01650
- Y117 (≠ V76) mutation to A: Strongly decreased leucine transport activity.
- C164 (≠ M129) modified: Interchain (with C-210 in SLC3A2)
- D223 (≠ H190) to V: in dbSNP:rs17853937
- N230 (≠ G197) to K: in dbSNP:rs1060250
- A246 (= A213) mutation to V: Nearly abolishes leucine transport activity.
- F252 (= F221) mutation to A: Nearly abolishes leucine transport activity.
- W257 (≠ F226) mutation to A: Nearly abolishes leucine transport activity.
- N258 (≠ Q227) mutation to A: Decreased leucine transport activity.; mutation to D: Nearly abolishes leucine transport activity.
- Y259 (≠ S228) mutation to A: Strongly decreased leucine transport activity.
- E303 (≠ D272) mutation to K: Decreased leucine transport activity.
- P375 (= P352) mutation to L: Nearly abolishes leucine transport activity.
Sites not aligning to the query:
- 483:507 mutation Missing: Nearly abolishes leucine transport activity.
6irtB Human lat1-4f2hc complex bound with bch (see paper)
25% identity, 78% coverage: 21:451/554 of query aligns to 10:424/457 of 6irtB
Q7YQK4 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; L-type amino acid transporter 1; LAT1; Solute carrier family 7 member 5 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
26% identity, 78% coverage: 21:451/554 of query aligns to 56:470/503 of Q7YQK4
- C88 (≠ G51) mutation to S: No significant effect on inhibition by HgCl(2). Decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-183.
- C98 (≠ T61) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Slightly less decreased KM and Vmax for Phe; when associated with S-183.
- C160 (≠ H133) mutation to S: No change to KM or Vmax for Phe.
- C172 (≠ A145) mutation to S: No change to KM or Vmax for Phe.
- C174 (≠ L147) mutation to S: No change to KM or Vmax for Phe.
- C183 (≠ F156) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-88. Slightly less decreased KM and Vmax for Phe; when associated with S-98.
- G219 (≠ F189) mutation to D: Decreased KM and Vmax for Trp. Increased KM and Vmax for Phe; when associated with L-234.
- W234 (≠ I205) mutation to L: Decreased KM and Vmax for Trp. Increased KM but decreased Vmax for Phe. Increased KM and Vmax for Phe; when associated with D-219.
- C331 (≠ G314) mutation to S: No significant effect on inhibition by HgCl(2). Increased KM and Vmax for Phe.
- C377 (≠ L358) mutation to S: No significant effect on inhibition by HgCl(2).
- C403 (≠ T388) mutation to S: No significant effect on inhibition by HgCl(2).
- C439 (≠ F420) mutation to S: Prevents insertion into the plasma membrane and possibly protein folding.
- C454 (≠ T435) mutation to S: No significant effect on inhibition by HgCl(2). Slightly increased KM but slightly decreased Vmax for Phe.
Sites not aligning to the query:
- 492 C→S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe.
7dsqB Overall structure of the lat1-4f2hc bound with 3,5-diiodo-l-tyrosine (see paper)
25% identity, 78% coverage: 21:451/554 of query aligns to 17:431/464 of 7dsqB
7dsnB Overall structure of the lat1-4f2hc bound with jx-119 (see paper)
25% identity, 78% coverage: 21:451/554 of query aligns to 17:431/464 of 7dsnB
- binding (2~{S})-2-azanyl-7-[[2-(1,3-benzoxazol-2-yl)phenyl]methoxy]-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: T19 (≠ S23), I20 (= I24), G22 (= G26), S23 (= S27), G24 (= G28), I97 (= I99), I104 (≠ M114), F209 (= F221), A210 (≠ S222), G212 (≠ N224), I354 (≠ A381), N361 (≠ T388)
- binding cholesterol hemisuccinate: F109 (≠ W119), Y145 (≠ W157), K148 (= K160), V153 (≠ S165), Q326 (≠ K346)
Sites not aligning to the query:
7dslB Overall structure of the lat1-4f2hc bound with jx-078 (see paper)
25% identity, 78% coverage: 21:451/554 of query aligns to 17:431/464 of 7dslB
7dskB Overall structure of the lat1-4f2hc bound with jx-075 (see paper)
25% identity, 78% coverage: 21:451/554 of query aligns to 17:431/464 of 7dskB
- binding (2~{S})-2-azanyl-7-(naphthalen-1-ylmethoxy)-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: T19 (≠ S23), I20 (= I24), S23 (= S27), G24 (= G28), I97 (= I99), S100 (= S110), S101 (≠ V111), F209 (= F221), G212 (≠ N224), Y216 (≠ S228), V353 (= V380), I354 (≠ A381), N361 (≠ T388)
- binding cholesterol hemisuccinate: K148 (= K160), A149 (≠ L161), V153 (≠ S165), F157 (≠ I169), H324 (= H344)
Sites not aligning to the query:
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
26% identity, 83% coverage: 7:465/554 of query aligns to 35:482/531 of Q9QXW9
- Y130 (≠ I103) mutation to A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- N133 (≠ E106) mutation to S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
- F242 (= F221) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
26% identity, 82% coverage: 7:461/554 of query aligns to 36:479/535 of Q9UHI5
- I53 (= I24) binding
- Y93 (= Y62) mutation to A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- N134 (≠ E106) Important for substrate specificity; binding ; mutation to Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; mutation to S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- C154 (≠ H128) modified: Interchain (with C-210 in SLC3A2)
- W174 (≠ L153) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (= F221) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ N224) Important for substrate specificity; binding ; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ H280) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity
- N395 (≠ T382) binding ; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ I383) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ G389) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity
- R418 (= R405) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity
- V460 (≠ L446) to E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization
7b00A Human lat2-4f2hc complex in the apo-state (see paper)
26% identity, 80% coverage: 21:461/554 of query aligns to 10:439/457 of 7b00A
7cmiB The lat2-4f2hc complex in complex with leucine (see paper)
26% identity, 80% coverage: 21:461/554 of query aligns to 10:439/458 of 7cmiB
7cmhB The lat2-4f2hc complex in complex with tryptophan (see paper)
26% identity, 80% coverage: 21:461/554 of query aligns to 10:439/458 of 7cmhB
P24207 Phenylalanine-specific permease; Phenylalanine:H(+) symporter PheP from Escherichia coli (strain K12) (see 3 papers)
25% identity, 82% coverage: 2:456/554 of query aligns to 13:451/458 of P24207
- R26 (≠ F14) mutation R->G,S,Q: Strong decrease in phenylalanine transport activity.
- P54 (= P42) mutation to A: 50% of wild-type phenylalanine transport activity.; mutation to G: No change in phenylalanine transport activity.; mutation to L: 26% of wild-type phenylalanine transport activity.
- F87 (≠ M75) mutation to L: No effect on phenylalanine transport activity.
- F90 (≠ Y78) mutation to L: 65% of wild-type phenylalanine transport activity.
- Y92 (≠ H80) mutation to L: 41% of wild-type phenylalanine transport activity.
- Y94 (≠ S82) mutation to L: 69% of wild-type phenylalanine transport activity.
- W95 (≠ H83) mutation to L: 10% of wild-type phenylalanine transport activity.
- F98 (≠ L86) mutation to L: No effect on phenylalanine transport activity.
- F101 (= F89) mutation to L: 38% of wild-type phenylalanine transport activity.
- W105 (= W93) mutation to L: 39% of wild-type phenylalanine transport activity.
- Y107 (≠ N95) mutation to L: No effect on phenylalanine transport activity.
- W108 (= W96) mutation to L: 71% of wild-type phenylalanine transport activity.
- F111 (≠ I99) mutation to L: 60% of wild-type phenylalanine transport activity.; mutation to Y: Enables the transport of tryptophan to almost the same steady-state level as that of phenylalanine.
- E118 (= E106) mutation E->G,L,V,N: Loss of activity.
- K168 (≠ T170) mutation K->L,R: Strong decrease in phenylalanine transport activity.; mutation to N: Loss of activity.
- E226 (≠ Q227) mutation E->A,Q,K,R,W: Loss of activity.
- R252 (≠ V259) mutation R->D,E,F,W,P: Loss of activity.
- P341 (= P350) mutation to A: 5% of wild-type phenylalanine transport activity.; mutation P->G,Q,K,R: Loss of activity.; mutation to S: 3% of wild-type phenylalanine transport activity.; mutation to T: 17% of wild-type phenylalanine transport activity.
- P442 (= P447) mutation to A: 46% of wild-type phenylalanine transport activity.; mutation to G: 52% of wild-type phenylalanine transport activity.; mutation to L: 43% of wild-type phenylalanine transport activity.
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
24% identity, 81% coverage: 2:450/554 of query aligns to 3:430/438 of O34739
- C94 (≠ G91) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (≠ V150) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (≠ A183) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (≠ T315) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
- C415 (≠ T435) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
26% identity, 71% coverage: 5:398/554 of query aligns to 9:386/457 of P15993
- Y103 (≠ I99) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
P46349 Gamma-aminobutyric acid permease; GABA permease; 4-aminobutyrate permease; Gamma-aminobutyrate permease; Proline transporter GabP from Bacillus subtilis (strain 168) (see paper)
25% identity, 72% coverage: 2:398/554 of query aligns to 3:384/469 of P46349
- G33 (= G32) mutation to D: Lack of activity.
- G42 (= G41) mutation to S: Lack of activity.
- G301 (= G316) mutation to V: Lack of activity.
- G338 (≠ N357) mutation to E: Lack of activity.
- F341 (≠ V360) mutation to S: Lack of activity.
Sites not aligning to the query:
- 414 G→R: Lack of activity.
P82251 b(0,+)-type amino acid transporter 1; b(0,+)AT1; Glycoprotein-associated amino acid transporter b0,+AT1; Solute carrier family 7 member 9 from Homo sapiens (Human) (see 11 papers)
22% identity, 82% coverage: 3:458/554 of query aligns to 22:461/487 of P82251
- V40 (≠ L21) to M: in CSNU; uncertain significance
- IIGSG 43:47 (= IIGSG 24:28) binding
- I44 (= I25) to T: in CSNU; type I; dbSNP:rs121908485
- S51 (≠ G32) to F: in CSNU; uncertain significance
- P52 (vs. gap) to L: in CSNU; impairs protein stability and dimer formation; dbSNP:rs1198613438
- A70 (= A47) to V: in CSNU; partial loss of amino acid transport activity; dbSNP:rs769448665
- Y99 (= Y78) to H: in CSNU; uncertain significance
- G105 (= G84) to R: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908480
- W114 (= W93) to R: in CSNU; uncertain significance
- I120 (vs. gap) to L: in CSNU; uncertain significance
- T123 (vs. gap) to M: in CSNU; partial loss of amino acid transport activity; dbSNP:rs79987078
- V142 (≠ M114) to A: no effect on amino acid transport activity; dbSNP:rs12150889
- C144 (≠ S116) modified: Interchain (with C-114 in SLC3A1)
- V170 (= V159) to M: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908479
- A182 (≠ I171) to T: in CSNU; type III; partial loss of amino acid transport activity; dbSNP:rs79389353
- G195 (= G181) to R: in CSNU; type III; decreased amino acid transport activity; dbSNP:rs121908482
- L223 (≠ V214) to M: slightly decreased amino acid transport activity; dbSNP:rs1007160
- A224 (= A215) to V: in CSNU; non-classic type I; dbSNP:rs140873167
- N227 (≠ G218) to D: in CSNU; decreased amino acid transport activity
- W230 (≠ F221) to R: in CSNU; complete loss of amino acid transport activity; mutation to A: Abolishes amino acid transport activity.
- D233 (≠ N224) binding ; mutation to A: Complete loss of amino acid transport activity.
- W235 (≠ F226) mutation to A: Complete loss of amino acid transport activity.
- Q237 (≠ S228) mutation to A: Reduces amino acid transport activity.
- G259 (≠ S250) to R: in CSNU; type III; impairs protein stability and dimer formation; dbSNP:rs121908483
- P261 (≠ V252) to L: in CSNU; types I and III; dbSNP:rs121908486
- S286 (≠ A277) to F: in CSNU; uncertain significance; dbSNP:rs755135545
- C321 (≠ T318) mutation to S: Does not affect amino acid transport activity.
- A324 (= A321) to E: in CSNU; uncertain significance
- V330 (≠ G329) to M: in CSNU; type III; dbSNP:rs201618022
- A331 (≠ M330) to V: in CSNU; non-classic type I; dbSNP:rs768466784
- R333 (= R332) to Q: in CSNU; decreased amino acid transport activity; dbSNP:rs769576205; to W: in CSNU; severe loss of amino acid transport activity; dbSNP:rs121908484
- A354 (= A353) to T: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs939028046
- S379 (= S379) mutation to A: Markedly reduces amino acid transport activity.
- A382 (≠ T382) to T: in CSNU; severe loss of amino acid transport activity; dbSNP:rs774878350
- W383 (≠ I383) mutation to A: Complete loss of amino acid transport activity.
- Y386 (= Y386) mutation to A: Loss of amino acid transport activity.
- K401 (≠ P401) to E: in CSNU; uncertain significance; dbSNP:rs760264924
- L426 (≠ A423) to P: in CSNU; uncertain significance
Sites not aligning to the query:
- 482 P → L: in CSNU; severe loss of amino acid transport activity; no effect on localization to the apical membrane; dbSNP:rs146815072; mutation P->A,G,S,V: No effect on amino acid transport activity.; mutation P->F,I,M,W: Decreased amino acid transport activity.
Query Sequence
>N515DRAFT_4366 FitnessBrowser__Dyella79:N515DRAFT_4366
MSSSSPIRRDVGPFALMLTGLGSIIGSGWLFGAWRAAGLAGPGAIWAWVLGAAIIMTIAL
TYAELGAMFPESGGMVRYSHYSHGSLVGFIGAWANWIAIVSVIPVEAEASVQYMASWPWK
WAQDLYMHMPDGHGELSEPGLGIAAVLVIVYFLLNFWSVKLFARSNTAITIFKLIVPAAT
GIALIASGFHSENFSVGVHGDAHAIDLAAVLTAVATAGIVFSFNGFQSPVNLAGEAHNPG
KSIPFAVIGSIVLATIVYVILQLAYLGSVPPDLLAKAGWHGIDFRSPFAELAIIVNLHWL
AMLLYVDAFISPSGTGITYTATTARMIYGMERNGTLPKILGRIHPKWGIPRPAMWFNLAV
SYLFLFKFRGWGTLAAVISVATIISYLTGPVSAMTLRRTAPNLHRPLRIAGLPILAGIAF
IMATELLYWAKWPLTGEIILLMVVALPVYFFYQFKAGWHDFGRQLKGAWWLIFYLPTLAL
VSWAGSTMFGGKGYLSYGMDLAVVAVVGLVFYLWGVKSGWRTPSVEAAELEAQAHPGAPL
VPPDELESERMTGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory