SitesBLAST
Comparing PP_2368 FitnessBrowser__Putida:PP_2368 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
41% identity, 97% coverage: 2:260/267 of query aligns to 12:267/275 of A0QV10
- K262 (≠ R255) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3wbwA Crystal structure of gox0644 in complex with NADPH
39% identity, 95% coverage: 2:255/267 of query aligns to 13:261/271 of 3wbwA
- active site: D45 (= D34), Y50 (= Y39), K71 (= K64), H104 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), H104 (= H97), N136 (= N130), W183 (≠ Y178), R184 (≠ M179), P185 (≠ T180), L186 (= L181), L192 (= L187), A209 (= A204), K226 (≠ S221), S227 (= S222), V228 (≠ T223), R232 (≠ N227), E235 (≠ S230), N236 (= N231)
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
37% identity, 97% coverage: 1:260/267 of query aligns to 14:277/283 of 4g5dA
- active site: D48 (= D34), Y53 (= Y39), K78 (= K64), H111 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G9), V23 (≠ T10), W24 (≠ F11), D48 (= D34), Y53 (= Y39), H111 (= H97), S148 (= S129), N149 (= N130), Q170 (= Q152), W196 (≠ Y178), S197 (≠ M179), P198 (≠ T180), L199 (= L181), Q201 (≠ Y183), G202 (= G184), L205 (= L187), I237 (= I219), P238 (= P220), K239 (≠ S221), S240 (= S222), V241 (≠ T223), H242 (≠ K224), R245 (≠ N227), E248 (≠ S230), N249 (= N231)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
36% identity, 99% coverage: 1:264/267 of query aligns to 10:274/277 of 4fziA
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
39% identity, 97% coverage: 2:260/267 of query aligns to 12:267/274 of 2wzmA
- active site: D44 (= D34), Y49 (= Y39), K74 (= K64), H107 (= H97)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y178), G187 (≠ M179), P188 (≠ T180), L189 (= L181), G190 (≠ A182), V191 (≠ Y183), G192 (= G184), L195 (= L187), A212 (= A204), I227 (= I219), R229 (≠ S221), S230 (= S222), R235 (≠ N227), N239 (= N231), R265 (≠ S258)
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
39% identity, 97% coverage: 2:260/267 of query aligns to 21:276/283 of A0QV09
- G196 (≠ M179) binding
- L198 (= L181) binding
- V200 (≠ Y183) binding
- I236 (= I219) binding
- R238 (≠ S221) binding
- S239 (= S222) binding
- A240 (≠ T223) binding
- R244 (≠ N227) binding
- S247 (= S230) binding
- N248 (= N231) binding
- R274 (≠ S258) binding
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
36% identity, 99% coverage: 1:264/267 of query aligns to 21:285/288 of 4gieA
- active site: D55 (= D34), Y60 (= Y39), K85 (= K64), H118 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G9), W31 (≠ F11), D55 (= D34), Y60 (= Y39), H118 (= H97), W119 (= W98), N148 (= N130), Q169 (= Q152), W195 (≠ Y178), S196 (≠ M179), P197 (≠ T180), L198 (= L181), S200 (≠ Y183), L207 (= L187), A224 (= A204), I239 (= I219), P240 (= P220), K241 (≠ S221), S242 (= S222), R247 (≠ N227), E250 (≠ S230), N251 (= N231)
5jh2A Crystal structure of the holo form of akr4c7 from maize (see paper)
37% identity, 94% coverage: 3:252/267 of query aligns to 12:256/257 of 5jh2A
- active site: D43 (= D34), Y48 (= Y39), K77 (= K64), H110 (= H97)
- binding adenosine-2'-5'-diphosphate: S185 (≠ M179), P186 (≠ T180), L187 (= L181), G188 (= G184), A208 (= A204), K225 (≠ S221), S226 (= S222), T227 (= T223), R231 (≠ N227), N235 (= N231)
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
40% identity, 97% coverage: 1:260/267 of query aligns to 14:269/275 of 3d3fA
- active site: D48 (= D34), Y53 (= Y39), K78 (= K64), H111 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G9), F24 (= F11), D48 (= D34), Y53 (= Y39), H111 (= H97), S140 (= S129), N141 (= N130), Q162 (= Q152), W188 (≠ Y178), S189 (≠ M179), P190 (≠ T180), L191 (= L181), Q193 (≠ Y183), L197 (= L187), I229 (= I219), K231 (≠ S221), S232 (= S222), K234 (= K224), R237 (≠ N227), E240 (≠ S230), N241 (= N231)
3b3dA B.Subtilis ytbe (see paper)
39% identity, 97% coverage: 1:260/267 of query aligns to 15:274/280 of 3b3dA
P80508 Prostaglandin-E(2) 9-reductase; 20-alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; EC 1.1.1.189; EC 1.1.1.149 from Oryctolagus cuniculus (Rabbit) (see paper)
35% identity, 97% coverage: 3:260/267 of query aligns to 16:309/323 of P80508
- TY 23:24 (≠ TF 10:11) binding
- D50 (= D34) binding
- F54 (≠ I38) mutation to L: 49% reduction in 20alpha-HSD activity; little effect on 3-alpha-HSD.; mutation to V: 73% reduction in 20alpha-HSD activity; little effect on 3-alpha-HSD.
- SN 166:167 (= SN 129:130) binding
- Q190 (= Q152) binding
- YSALGS 216:221 (≠ YMTLAY 178:183) binding
- 270:280 (vs. 221:231, 18% identical) binding
- V306 (= V257) mutation to F: Greatly reduced 3alpha-HSD activity toward DHT; little effect on 20alpha-HSD activity.
1q5mA Binary complex of rabbit 20alpha-hydroxysteroid dehydrogenase with NADPH (see paper)
35% identity, 97% coverage: 3:260/267 of query aligns to 15:308/322 of 1q5mA
- active site: D49 (= D34), Y54 (= Y39), K83 (= K64), H116 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G9), T22 (= T10), Y23 (≠ F11), D49 (= D34), Y54 (= Y39), H116 (= H97), Q189 (= Q152), Y215 (= Y178), S216 (≠ M179), L218 (= L181), S220 (≠ Y183), H221 (≠ G184), A252 (= A204), L267 (≠ I219), K269 (≠ S221), S270 (= S222), F271 (≠ T223), T272 (≠ K224), R275 (≠ N227), E278 (≠ S230), N279 (= N231)
1q13A Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with NADP and testosterone (see paper)
35% identity, 97% coverage: 3:260/267 of query aligns to 15:308/322 of 1q13A
- active site: D49 (= D34), Y54 (= Y39), K83 (= K64), H116 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G9), T22 (= T10), Y23 (≠ F11), D49 (= D34), Y54 (= Y39), H116 (= H97), Q189 (= Q152), Y215 (= Y178), S216 (≠ M179), L218 (= L181), S220 (≠ Y183), H221 (≠ G184), L235 (= L187), A252 (= A204), L267 (≠ I219), K269 (≠ S221), S270 (= S222), T272 (≠ K224), R275 (≠ N227), E278 (≠ S230), N279 (= N231)
- binding testosterone: Y23 (≠ F11), F53 (≠ I38), Y54 (= Y39), H116 (= H97), P224 (vs. gap)
3wczA Crystal structure of bombyx mori aldo-keto reductase (akr2e4) in complex with NADP (see paper)
37% identity, 95% coverage: 2:255/267 of query aligns to 14:292/307 of 3wczA
- active site: D52 (= D34), Y57 (= Y39), K86 (= K64), H119 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G9), T22 (= T10), G23 (≠ F11), T26 (= T14), D52 (= D34), Y57 (= Y39), H119 (= H97), Q179 (= Q152), Y205 (= Y178), S206 (≠ M179), P207 (≠ T180), F208 (≠ L181), R214 (vs. gap), I256 (= I219), P257 (= P220), K258 (≠ S221), S259 (= S222), T260 (= T223), R264 (≠ N227), N268 (= N231)
H9JTG9 Aldo-keto reductase AKR2E4; 3-dehydroecdysone reductase; Aldo-keto reductase 2E; EC 1.1.1.- from Bombyx mori (Silk moth) (see paper)
37% identity, 95% coverage: 2:255/267 of query aligns to 15:293/308 of H9JTG9
- 22:29 (vs. 9:16, 50% identical) binding
- D53 (= D34) binding
- SN 158:159 (= SN 129:130) binding
- R215 (vs. gap) binding
- 259:269 (vs. 221:231, 36% identical) binding
Q0PGJ6 NADPH-dependent aldo-keto reductase, chloroplastic; AtChlAKR; Aldo-keto reductase family 4 member C9; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 93% coverage: 4:252/267 of query aligns to 17:287/315 of Q0PGJ6
3h7uA Crystal structure of the plant stress-response enzyme akr4c9 (see paper)
35% identity, 93% coverage: 4:252/267 of query aligns to 14:284/312 of 3h7uA
- active site: S24 (≠ T14), D44 (= D34), Y49 (= Y39), K78 (= K64), H111 (= H97)
- binding acetate ion: W21 (≠ F11), Y49 (= Y39), H111 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G9), T20 (= T10), W21 (≠ F11), D44 (= D34), Y49 (= Y39), H111 (= H97), W112 (= W98), N156 (= N130), Q177 (= Q152), Y203 (= Y178), S204 (≠ M179), P205 (≠ T180), L206 (= L181), S208 (vs. gap), P209 (vs. gap), G210 (vs. gap), A236 (= A204), L251 (≠ I219), P252 (= P220), K253 (≠ S221), S254 (= S222), R259 (≠ N227), E262 (≠ S230), N263 (= N231)
7f7mA Akr4c17 in complex with NADP+ and glyphosate
37% identity, 94% coverage: 3:252/267 of query aligns to 12:282/309 of 7f7mA
- binding glyphosate: Y48 (= Y39), W79 (= W66), H110 (= H97), W111 (= W98)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G9), T19 (= T10), W20 (≠ F11), D43 (= D34), Y48 (= Y39), H110 (= H97), Q175 (= Q152), Y201 (= Y178), S202 (≠ M179), P203 (≠ T180), L204 (= L181), S206 (≠ Y183), P207 (vs. gap), A234 (= A204), L249 (≠ I219), P250 (= P220), K251 (≠ S221), S252 (= S222), T253 (= T223), R257 (≠ N227), N261 (= N231)
7f7lA Crystal structure of akr4c17 bound with NADPH
37% identity, 94% coverage: 3:252/267 of query aligns to 12:282/309 of 7f7lA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G18 (= G9), T19 (= T10), W20 (≠ F11), D43 (= D34), Y48 (= Y39), H110 (= H97), S153 (= S129), Q175 (= Q152), Y201 (= Y178), S202 (≠ M179), P203 (≠ T180), L204 (= L181), S206 (≠ Y183), P207 (vs. gap), G208 (vs. gap), A234 (= A204), L249 (≠ I219), P250 (= P220), K251 (≠ S221), S252 (= S222), T253 (= T223), R257 (≠ N227), N261 (= N231)
7f7kB Crystal structure of akr4c17 bound with NADP+
37% identity, 94% coverage: 3:252/267 of query aligns to 13:283/310 of 7f7kB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G9), T20 (= T10), W21 (≠ F11), D44 (= D34), Y49 (= Y39), H111 (= H97), S154 (= S129), Q176 (= Q152), Y202 (= Y178), S203 (≠ M179), P204 (≠ T180), L205 (= L181), S207 (≠ Y183), P208 (vs. gap), G209 (vs. gap), A235 (= A204), L250 (≠ I219), P251 (= P220), K252 (≠ S221), S253 (= S222), R258 (≠ N227), N262 (= N231)
Query Sequence
>PP_2368 FitnessBrowser__Putida:PP_2368
MSVPSFGLGTFRLTGQTVIDSVKSALAVGYRVIDTAQIYKNEAEVGQAIAESGVPRSELF
ITTKIWVDNYAADKLIPSLRDSLQKLRTDYVDLLLIHWPAPGNGVELPEYMKALADAKQQ
GLARQIGVSNFNIELTRQAIAVVGKGEIATNQIELSPYLQNSKLTAFLKEQGITVTSYMT
LAYGKVLKDPVLAQIAAKHKATVAQVALAWALQLGYAVIPSSTKRENLASNLLARGLTLD
TDDMARIAKLERNGREVSPDGLAPTWD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory