Comparing PP_2514 FitnessBrowser__Putida:PP_2514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
A5W059 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase; HMG/CHA aldolase; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.3.17; EC 4.1.1.112 from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) (see paper)
81% identity, 100% coverage: 1:238/238 of query aligns to 1:238/238 of A5W059
3nojA The structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida (see paper)
81% identity, 98% coverage: 4:236/238 of query aligns to 3:235/235 of 3nojA
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
28% identity, 47% coverage: 70:180/238 of query aligns to 46:156/156 of 1nxjA
Sites not aligning to the query:
>PP_2514 FitnessBrowser__Putida:PP_2514
MSGLIGKTGIVVRNIPRVEPHMIDALGRLGVATVHEAQGRKGLLNTAVRPIQQGVAVAGS
AVTVLVAPGDNWMFHVAVEQCRPGDVLVVAPSSPCSDGYFGDLLATSLQARGVLGLVIDA
GVRDSQTLRDMGFAVWSRAINAQGTVKEVLGSVNLPLLCAGQLVNAGDIVVADDDGVVVV
RHGEAQAVLEAATQRADLEERKRLRLAAGELGLDIYEMRPRLAAKGLRYVDHLTDLEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory