SitesBLAST
Comparing PP_2831 FitnessBrowser__Putida:PP_2831 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7L5Y1 Mitochondrial enolase superfamily member 1; Antisense RNA to thymidylate synthase; rTS; L-fuconate dehydratase; EC 4.2.1.68 from Homo sapiens (Human) (see 5 papers)
61% identity, 99% coverage: 1:405/411 of query aligns to 28:434/443 of Q7L5Y1
- M145 (≠ Q118) to T: in dbSNP:rs2612086
- S148 (≠ R121) modified: Phosphoserine
- D250 (= D223) binding
- E276 (= E249) binding
- E305 (= E276) binding
Sites not aligning to the query:
- 1:27 mutation Missing: Impairs protein solubility. Abolishes catalytic activity.
4a35A Crystal structure of human mitochondrial enolase superfamily member 1 (enosf1) (see paper)
61% identity, 99% coverage: 1:405/411 of query aligns to 29:435/441 of 4a35A
- active site: K221 (= K193), K223 (= K195), D251 (= D223), N253 (= N225), E277 (= E249), E306 (= E276), D329 (= D299), H356 (= H326), S380 (= S350), E387 (= E357)
- binding magnesium ion: Y188 (= Y160), D251 (= D223), E277 (= E249), E306 (= E276), Y374 (= Y344)
4ip5A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg and d-erythronohydroxamate
59% identity, 97% coverage: 1:399/411 of query aligns to 25:421/421 of 4ip5A
- active site: K217 (= K195), D245 (= D223), N247 (= N225), E271 (= E249), E298 (= E276), D321 (= D299), H348 (= H326), E379 (= E357)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: Y31 (= Y7), K215 (= K193), K217 (= K195), D245 (= D223), N247 (= N225), E298 (= E276), H348 (= H326)
- binding magnesium ion: D245 (= D223), E271 (= E249), E298 (= E276)
Sites not aligning to the query:
4ip4A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg
59% identity, 97% coverage: 1:399/411 of query aligns to 25:421/421 of 4ip4A
Q8P3K2 L-fuconate dehydratase; FucD; EC 4.2.1.68 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
56% identity, 99% coverage: 1:407/411 of query aligns to 26:432/441 of Q8P3K2
- Y32 (= Y7) binding
- K218 (= K193) binding
- K220 (= K195) mutation to A: Inactive.
- D248 (= D223) binding
- N250 (= N225) binding
- E274 (= E249) binding ; binding
- E301 (= E276) binding ; binding
- HAG 351:353 (≠ HGG 326:328) binding
- E382 (= E357) binding
Sites not aligning to the query:
1yeyC Crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. Campestris str. Atcc 33913
56% identity, 99% coverage: 1:407/411 of query aligns to 26:432/435 of 1yeyC
- active site: T55 (= T29), T190 (= T165), K218 (= K193), K220 (= K195), D248 (= D223), N250 (= N225), E274 (= E249), G300 (= G275), E301 (= E276), D324 (= D299), P350 (= P325), H351 (= H326), A352 (≠ G327), D368 (= D343), K375 (≠ S350), E382 (= E357)
- binding magnesium ion: D248 (= D223), E274 (= E249), E301 (= E276)
2hxtA Crystal structure of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and d-erythronohydroxamate (see paper)
56% identity, 99% coverage: 1:407/411 of query aligns to 25:431/434 of 2hxtA
- active site: T54 (= T29), T189 (= T165), K217 (= K193), K219 (= K195), D247 (= D223), N249 (= N225), E273 (= E249), G299 (= G275), E300 (= E276), D323 (= D299), P349 (= P325), H350 (= H326), A351 (≠ G327), D367 (= D343), K374 (≠ S350), E381 (= E357)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: Y31 (= Y7), K217 (= K193), K219 (= K195), E300 (= E276), H350 (= H326), G352 (= G328), E381 (= E357)
- binding magnesium ion: D247 (= D223), E273 (= E249), E300 (= E276)
Sites not aligning to the query:
2hxuA Crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate (see paper)
56% identity, 99% coverage: 1:407/411 of query aligns to 25:431/434 of 2hxuA
- active site: T54 (= T29), T189 (= T165), K217 (= K193), A219 (≠ K195), D247 (= D223), N249 (= N225), E273 (= E249), G299 (= G275), E300 (= E276), D323 (= D299), P349 (= P325), H350 (= H326), A351 (≠ G327), D367 (= D343), K374 (≠ S350), E381 (= E357)
- binding 6-deoxy-L-galactonic acid: Y31 (= Y7), W193 (= W169), K217 (= K193), D247 (= D223), E300 (= E276), H350 (= H326), G352 (= G328), E381 (= E357)
- binding magnesium ion: D247 (= D223), E273 (= E249), E300 (= E276)
Sites not aligning to the query:
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
28% identity, 93% coverage: 16:397/411 of query aligns to 38:367/372 of 4h19A
- active site: T51 (= T29), T143 (= T165), K172 (= K193), K174 (= K195), D203 (= D223), N205 (= N225), E229 (= E249), G254 (= G275), E255 (= E276), Q276 (= Q297), D278 (= D299), H305 (= H326), A306 (≠ G327), G307 (= G328), E327 (= E357)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: H52 (vs. gap), K172 (= K193), K174 (= K195), D203 (= D223), N205 (= N225), E229 (= E249), E255 (= E276), H305 (= H326), E327 (= E357)
- binding calcium ion: D268 (≠ Q289), H298 (≠ Y319)
- binding magnesium ion: D203 (= D223), E229 (= E249), E255 (= E276)
Sites not aligning to the query:
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
27% identity, 92% coverage: 17:396/411 of query aligns to 38:354/357 of 3ck5A
- active site: T50 (= T29), G137 (≠ Y127), K164 (= K193), K166 (= K195), D195 (= D223), N197 (= N225), I220 (= I248), E221 (= E249), I243 (≠ V272), G246 (= G275), E247 (= E276), E268 (≠ Q297), D270 (= D299), H297 (= H326), G298 (= G327), V299 (= V336), Y315 (≠ V355), E317 (= E357)
- binding magnesium ion: D195 (= D223), E221 (= E249), E247 (= E276)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
27% identity, 92% coverage: 17:396/411 of query aligns to 38:357/361 of Q9RKF7
- D195 (= D223) binding
- E221 (= E249) binding
- E247 (= E276) binding
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
32% identity, 53% coverage: 183:401/411 of query aligns to 154:377/378 of 4hpnA
- active site: K164 (= K193), K166 (= K195), D194 (= D223), N196 (= N225), E220 (= E249), G245 (= G275), E246 (= E276), T247 (≠ H277), Q267 (= Q297), D269 (= D299), H296 (= H326), V297 (vs. gap), W298 (vs. gap), R320 (≠ S348), E329 (= E357), F330 (≠ Y358), H334 (= H363)
- binding calcium ion: D194 (= D223), D209 (≠ R238), E220 (= E249), G237 (≠ R266), E246 (= E276)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
28% identity, 52% coverage: 186:397/411 of query aligns to 141:348/351 of 5olcC
- active site: K148 (= K193), K150 (= K195), D178 (= D223), N180 (= N225), E204 (= E249), G229 (= G275), E230 (= E276), D253 (= D299), H280 (= H326), E304 (≠ Y358), E309 (≠ H363)
- binding magnesium ion: D178 (= D223), E204 (= E249), E230 (= E276)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
24% identity, 89% coverage: 42:406/411 of query aligns to 62:375/376 of 3bjsB
- active site: L93 (≠ P79), G136 (≠ E150), K164 (= K193), R166 (≠ K195), D194 (= D223), N196 (= N225), E220 (= E249), G246 (= G275), E247 (= E276), N248 (≠ H277), Q268 (= Q297), D270 (= D299), H297 (= H326), S298 (≠ G327), S299 (≠ G328), E322 (≠ N353), C324 (≠ V355), K327 (≠ Y358)
- binding magnesium ion: D194 (= D223), E220 (= E249), E247 (= E276)
Sites not aligning to the query:
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
29% identity, 75% coverage: 20:326/411 of query aligns to 69:325/395 of 2pp1A
- active site: S78 (≠ T29), K192 (= K193), K194 (= K195), D223 (= D223), N225 (= N225), E249 (= E249), G274 (= G275), E275 (= E276), D298 (= D299), H325 (= H326)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: K79 (≠ I30), F168 (≠ W169), K194 (= K195), E275 (= E276), H325 (= H326)
- binding magnesium ion: D223 (= D223), E249 (= E249), E275 (= E276)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 75% coverage: 20:326/411 of query aligns to 72:328/398 of Q8ZL58
- KR 82:83 (≠ IG 30:31) binding
- K195 (= K193) binding
- K197 (= K195) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D223) binding
- N228 (= N225) binding
- E252 (= E249) binding
- E278 (= E276) binding
- H328 (= H326) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
Sites not aligning to the query:
- 46:48 binding
- 348 binding
3stpA Crystal structure of a putative galactonate dehydratase
26% identity, 73% coverage: 29:328/411 of query aligns to 58:318/390 of 3stpA
- active site: L66 (≠ C37), S69 (≠ A40), S151 (≠ D124), K177 (= K193), R179 (≠ K195), P189 (≠ A198), E214 (≠ D223), Y216 (≠ N225), E240 (= E249), G265 (= G275), E266 (= E276), H267 (= H277), Q287 (= Q297), D289 (= D299), I311 (≠ V321), H316 (= H326)
- binding magnesium ion: E214 (≠ D223), E240 (= E249), E266 (= E276)
Sites not aligning to the query:
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
26% identity, 77% coverage: 82:398/411 of query aligns to 99:361/367 of 5xd8B
- active site: G140 (≠ Y127), K167 (= K193), K169 (= K195), D198 (= D223), N200 (= N225), E224 (= E249), G249 (= G275), E250 (= E276), Q271 (= Q297), D273 (= D299), H300 (= H326), G301 (= G327), M302 (≠ V336), W317 (≠ V355), E319 (= E357), P324 (≠ F366)
- binding magnesium ion: D198 (= D223), E224 (= E249), E250 (= E276)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
28% identity, 75% coverage: 20:326/411 of query aligns to 69:325/395 of 2pp3A
- active site: S78 (≠ T29), K192 (= K193), A194 (≠ K195), D223 (= D223), N225 (= N225), E249 (= E249), G274 (= G275), E275 (= E276), D298 (= D299), H325 (= H326)
- binding l-glucaric acid: K79 (≠ I30), K192 (= K193), D223 (= D223), N225 (= N225), E275 (= E276), H325 (= H326)
- binding magnesium ion: D223 (= D223), E249 (= E249), E275 (= E276)
Sites not aligning to the query:
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
27% identity, 84% coverage: 44:389/411 of query aligns to 68:364/381 of 3ozmD
- active site: S143 (≠ F125), K170 (= K193), K172 (= K195), D200 (= D223), N202 (= N225), E226 (= E249), G252 (= G275), E253 (= E276), N254 (≠ H277), Q274 (= Q297), D276 (= D299), H303 (= H326), T304 (≠ G327), F305 (≠ G328), E328 (= E357), I331 (≠ H361), H333 (= H363)
- binding L-arabinaric acid: K172 (= K195), D200 (= D223), N202 (= N225), E253 (= E276), H303 (= H326), F305 (≠ G328), E328 (= E357)
- binding magnesium ion: D200 (= D223), E226 (= E249), E253 (= E276)
Sites not aligning to the query:
Query Sequence
>PP_2831 FitnessBrowser__Putida:PP_2831
MNSAPDYSAAYVVLHTDAAALEGHGLTFTIGRGNEICAAAVQSLAPLIVGLTLEEISADM
GAFWHRFTVSDSQLRWLGPEKGVIHLATAAIINAVWDLWAKHEGKPVWKLLADMTPEQLV
RCLDFSYVTDVLTPEEAIALLRRQAPGKAEREAHMLREGYPGYTTAPGWLGYSEEKMRKL
AREAVADGWTHIKQKIGADLEEDIRRASILRDEIGWERTLMMDANQVWGVEESVANMRRL
AAFEPLWIEEPTSPDDILGHATIRQRIAPIGVATGEHCHNRVMFKQMFQAGALDFCQLDA
ARLGGLNEVLIVLLMAAKYDVPVCPHGGGVGLCEYVQNIALFDYIAVSASLHNRVLEYVD
HLHEHFIDPVVIHRGRYMPPQRPGYSIEMHAETLERYQYPNGAVWLDINRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory