SitesBLAST
Comparing PP_3191 FitnessBrowser__Putida:PP_3191 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:342/350 of query aligns to 3:316/323 of 7nbfAAA
- active site: K53 (= K84), S81 (= S109), E207 (≠ W235), A211 (vs. gap), D213 (≠ P240), G236 (= G263), L309 (= L335), S310 (≠ C336)
- binding calcium ion: E207 (≠ W235), A211 (vs. gap), D213 (≠ P240)
- binding magnesium ion: D3 (= D34), N244 (≠ I273)
- binding pyridoxal-5'-phosphate: F52 (= F83), K53 (= K84), N83 (= N111), G182 (= G210), G183 (= G211), G184 (= G212), G185 (= G213), M186 (= M214), G236 (= G263), V237 (≠ T264), T282 (≠ A311), S310 (≠ C336), G311 (= G337)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ S52), L22 (≠ I53), T23 (= T54), P24 (= P55), L26 (= L57), T27 (≠ H58), F46 (≠ L77)
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:342/350 of query aligns to 3:316/323 of 7nbdAAA
- active site: K53 (= K84), S81 (= S109), E207 (≠ W235), A211 (vs. gap), D213 (≠ P240), G236 (= G263), L309 (= L335), S310 (≠ C336)
- binding calcium ion: E207 (≠ W235), A211 (vs. gap), D213 (≠ P240)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ A301), L278 (≠ I307), V314 (≠ I340), L316 (= L342)
- binding magnesium ion: D3 (= D34), N244 (≠ I273)
- binding pyridoxal-5'-phosphate: F52 (= F83), K53 (= K84), N83 (= N111), G182 (= G210), G183 (= G211), G184 (= G212), G185 (= G213), M186 (= M214), G236 (= G263), V237 (≠ T264), E280 (= E309), T282 (≠ A311), S310 (≠ C336), G311 (= G337)
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:342/350 of query aligns to 3:316/323 of 7nbcCCC
- active site: K53 (= K84), S81 (= S109), E207 (≠ W235), A211 (vs. gap), D213 (≠ P240), G236 (= G263), L309 (= L335), S310 (≠ C336)
- binding biphenyl-4-ylacetic acid: T78 (≠ A106), H79 (≠ A107), H84 (= H112), V148 (= V176), H149 (≠ S177), P150 (= P178)
- binding calcium ion: E207 (≠ W235), A211 (vs. gap), D213 (≠ P240)
- binding pyridoxal-5'-phosphate: F52 (= F83), K53 (= K84), N83 (= N111), G182 (= G210), G183 (= G211), G184 (= G212), G185 (= G213), M186 (= M214), G236 (= G263), V237 (≠ T264), T282 (≠ A311), S310 (≠ C336), G311 (= G337)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:342/350 of query aligns to 3:316/323 of 7nbcAAA
- active site: K53 (= K84), S81 (= S109), E207 (≠ W235), A211 (vs. gap), D213 (≠ P240), G236 (= G263), L309 (= L335), S310 (≠ C336)
- binding calcium ion: E207 (≠ W235), A211 (vs. gap), D213 (≠ P240)
- binding magnesium ion: D3 (= D34), N244 (≠ I273)
- binding pyridoxal-5'-phosphate: F52 (= F83), K53 (= K84), N83 (= N111), G182 (= G210), G183 (= G211), G184 (= G212), G185 (= G213), M186 (= M214), G236 (= G263), V237 (≠ T264), T282 (≠ A311), S310 (≠ C336), G311 (= G337)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:342/350 of query aligns to 3:316/322 of 7nbgAAA
- active site: K53 (= K84), S81 (= S109), E207 (≠ W235), A211 (vs. gap), D213 (≠ P240), G236 (= G263), L309 (= L335), S310 (≠ C336)
- binding calcium ion: E207 (≠ W235), A211 (vs. gap), D213 (≠ P240)
- binding pyridoxal-5'-phosphate: F52 (= F83), K53 (= K84), N83 (= N111), G182 (= G210), G183 (= G211), G184 (= G212), G185 (= G213), M186 (= M214), G236 (= G263), V237 (≠ T264), T282 (≠ A311), S310 (≠ C336), G311 (= G337)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S109), G85 (= G113), Q86 (= Q114), I101 (≠ V129), K111 (= K139), I115 (≠ M143), Y118 (≠ L146)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:342/350 of query aligns to 3:316/320 of 7nbhAAA
- active site: K53 (= K84), S81 (= S109), E207 (≠ W235), A211 (vs. gap), D213 (≠ P240), G236 (= G263), L309 (= L335), S310 (≠ C336)
- binding calcium ion: E207 (≠ W235), A211 (vs. gap), D213 (≠ P240)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S109), G85 (= G113), Q86 (= Q114), K111 (= K139), I115 (≠ M143), Y118 (≠ L146), D235 (= D262), P281 (≠ G310), N313 (= N339), V314 (≠ I340), D315 (≠ L341)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
37% identity, 92% coverage: 30:350/350 of query aligns to 1:320/322 of 3l6bA
- active site: K54 (= K84), S77 (= S109), E203 (≠ W235), A207 (vs. gap), D209 (≠ P240), G232 (= G263), T278 (≠ A311), L305 (= L335), S306 (≠ C336)
- binding malonate ion: K54 (= K84), S76 (= S108), S77 (= S109), N79 (= N111), H80 (= H112), R128 (≠ S159), G232 (= G263)
- binding manganese (ii) ion: E203 (≠ W235), A207 (vs. gap), D209 (≠ P240)
- binding pyridoxal-5'-phosphate: F53 (= F83), K54 (= K84), N79 (= N111), G178 (= G210), G179 (= G211), G180 (= G212), G181 (= G213), M182 (= M214), V233 (≠ T264), E276 (= E309), T278 (≠ A311), S306 (≠ C336), G307 (= G337)
6zspAAA serine racemase bound to atp and malonate. (see paper)
36% identity, 91% coverage: 34:350/350 of query aligns to 3:317/320 of 6zspAAA
- active site: K53 (= K84), S74 (= S109), E200 (≠ W235), A204 (vs. gap), D206 (≠ P240), G229 (= G263), L302 (= L335), S303 (≠ C336)
- binding adenosine-5'-triphosphate: S28 (= S59), S29 (≠ P60), I30 (≠ R61), K48 (≠ H79), T49 (= T80), Q79 (= Q114), Y111 (≠ L146), E266 (≠ S302), R267 (≠ S303), K269 (≠ R305), N306 (= N339)
- binding magnesium ion: E200 (≠ W235), A204 (vs. gap), D206 (≠ P240)
- binding malonate ion: K53 (= K84), S73 (= S108), S74 (= S109), N76 (= N111), H77 (= H112), R125 (≠ S159), G229 (= G263), S232 (≠ G266)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
37% identity, 88% coverage: 34:340/350 of query aligns to 3:309/310 of 7nbgDDD
- active site: K53 (= K84), S76 (= S109), E202 (≠ W235), A206 (vs. gap), D208 (≠ P240), G231 (= G263), L304 (= L335), S305 (≠ C336)
- binding calcium ion: E202 (≠ W235), A206 (vs. gap), D208 (≠ P240)
- binding magnesium ion: D3 (= D34), N239 (≠ I273)
- binding ortho-xylene: S76 (= S109), Q81 (= Q114), I96 (≠ V129), Y113 (≠ L146)
- binding pyridoxal-5'-phosphate: F52 (= F83), K53 (= K84), N78 (= N111), G177 (= G210), G178 (= G211), G179 (= G212), G180 (= G213), M181 (= M214), G231 (= G263), V232 (≠ T264), E275 (= E309), T277 (≠ A311), S305 (≠ C336), G306 (= G337)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
37% identity, 89% coverage: 33:345/350 of query aligns to 3:313/319 of A4F2N8
- K53 (= K84) mutation to A: Loss of enzymatic activity.
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 89% coverage: 38:349/350 of query aligns to 22:336/339 of Q7XSN8
- E219 (≠ W235) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ T241) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 88% coverage: 37:345/350 of query aligns to 10:317/323 of O59791
- S82 (= S109) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
32% identity, 88% coverage: 37:345/350 of query aligns to 5:312/318 of 1wtcA
- active site: K52 (= K84), S77 (= S109), E203 (≠ W235), G207 (≠ D239), D209 (≠ T241), G231 (= G263), I302 (≠ L335), S303 (≠ C336)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ S52), K47 (≠ H79), M48 (≠ T80), A109 (≠ E141), A110 (= A142), Y114 (≠ L146)
- binding magnesium ion: E203 (≠ W235), G207 (≠ D239), D209 (≠ T241)
- binding pyridoxal-5'-phosphate: F51 (= F83), K52 (= K84), N79 (= N111), G178 (= G210), G179 (= G211), G180 (= G212), G181 (= G213), G231 (= G263), E276 (= E309), T278 (≠ A311), S303 (≠ C336)
1v71A Crystal structure of s.Pombe serine racemase
32% identity, 88% coverage: 37:345/350 of query aligns to 5:312/318 of 1v71A
- active site: K52 (= K84), S77 (= S109), E203 (≠ W235), G207 (≠ D239), D209 (≠ T241), G231 (= G263), I302 (≠ L335), S303 (≠ C336)
- binding magnesium ion: E203 (≠ W235), G207 (≠ D239), D209 (≠ T241)
- binding pyridoxal-5'-phosphate: F51 (= F83), K52 (= K84), N79 (= N111), G178 (= G210), G179 (= G211), G180 (= G212), G181 (= G213), G231 (= G263), E276 (= E309), T278 (≠ A311), S303 (≠ C336), G304 (= G337)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
32% identity, 88% coverage: 37:345/350 of query aligns to 6:313/319 of 2zr8A
- active site: K53 (= K84), S78 (= S109), E204 (≠ W235), G208 (≠ D239), D210 (≠ T241), G232 (= G263), I303 (≠ L335), S304 (≠ C336)
- binding magnesium ion: E204 (≠ W235), G208 (≠ D239), D210 (≠ T241)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F83), K53 (= K84), S77 (= S108), S78 (= S109), N80 (= N111), H81 (= H112), P147 (= P178), G179 (= G210), G180 (= G211), G181 (= G212), G182 (= G213), G232 (= G263), E277 (= E309), T279 (≠ A311), S304 (≠ C336)
- binding serine: S78 (= S109), R129 (≠ A160), D231 (= D262), G232 (= G263), A233 (= A265), Q234 (≠ G266), T235 (≠ G267)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
32% identity, 88% coverage: 37:345/350 of query aligns to 6:313/319 of 2zpuA
- active site: K53 (= K84), S78 (= S109), E204 (≠ W235), G208 (≠ D239), D210 (≠ T241), G232 (= G263), I303 (≠ L335), S304 (≠ C336)
- binding magnesium ion: E204 (≠ W235), G208 (≠ D239), D210 (≠ T241)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F83), K53 (= K84), S77 (= S108), S78 (= S109), N80 (= N111), H81 (= H112), P147 (= P178), G179 (= G210), G180 (= G211), G181 (= G212), G182 (= G213), G232 (= G263), E277 (= E309), T279 (≠ A311), S304 (≠ C336)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
36% identity, 87% coverage: 39:342/350 of query aligns to 11:319/339 of Q9QZX7
- C113 (≠ Y138) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
3hmkA Crystal structure of serine racemase (see paper)
36% identity, 89% coverage: 30:342/350 of query aligns to 1:317/321 of 3hmkA
- active site: K54 (= K84), S82 (= S109), E208 (≠ W235), A212 (≠ D239), D214 (≠ T241), G237 (= G263), T283 (≠ A311), L310 (= L335), S311 (≠ C336)
- binding manganese (ii) ion: E208 (≠ W235), A212 (≠ D239), D214 (≠ T241)
- binding pyridoxal-5'-phosphate: F53 (= F83), K54 (= K84), N84 (= N111), G183 (= G210), G184 (= G211), G185 (= G212), G186 (= G213), M187 (= M214), G237 (= G263), V238 (≠ T264), T283 (≠ A311), S311 (≠ C336), G312 (= G337)
5cvcA Structure of maize serine racemase (see paper)
32% identity, 87% coverage: 38:342/350 of query aligns to 6:313/329 of 5cvcA
- active site: K52 (= K84), S77 (= S109), E203 (≠ W235), A207 (≠ D239), D209 (≠ T241), G231 (= G263), V306 (≠ L335), S307 (≠ C336)
- binding magnesium ion: E203 (≠ W235), A207 (≠ D239), D209 (≠ T241)
- binding pyridoxal-5'-phosphate: F51 (= F83), K52 (= K84), N79 (= N111), S178 (≠ G210), G179 (= G211), G180 (= G212), G181 (= G213), L232 (≠ T264), E275 (= E309), S307 (≠ C336), G308 (= G337)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
36% identity, 88% coverage: 38:344/350 of query aligns to 10:317/326 of 2gn2A
- active site: K56 (= K84), A81 (≠ S109), Q207 (≠ W235), V211 (≠ D239), G213 (≠ T241), G235 (= G263), I308 (≠ L335), S309 (≠ C336)
- binding cytidine-5'-monophosphate: R51 (≠ H79), T52 (= T80), G53 (= G81), A114 (= A142), D117 (≠ A145), Y118 (≠ L146), N312 (= N339)
Query Sequence
>PP_3191 FitnessBrowser__Putida:PP_3191
MLFVEYYSMVDKLSTRLQGPVMPATPSVDAQFLDTLHQNIQDAHAALRPAVSITPLLHSP
RLSALTGCEVLLKCEHLQHTGSFKFRGASNKMRLLPAEARKQGVIAASSGNHGQALALAG
KMAGVPVKVYTTTGASAYKTEAMRALGAEVVCLPTDPLSAELEAARQAKAQGVPFVSPYN
DLQVIAGQGTIGMELLEQAPDLDAVFVAVGGGGMISGIGAALRVLKPGTEIIGCWPANDP
TLQQSLKAGEIIELDACETLSDGTAGGVEPGSITFPLCQALLTDTVLVSEDEIRCAMRDI
ASSERWIIEGAAAVAVAGMQRLAERYQGKRVAVILCGRNILLEKFLEAVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory