SitesBLAST
Comparing PP_4431 FitnessBrowser__Putida:PP_4431 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
33% identity, 98% coverage: 3:325/330 of query aligns to 2:314/320 of 1omoA
- active site: R52 (≠ D56), D219 (= D229)
- binding nicotinamide-adenine-dinucleotide: T109 (= T116), G134 (= G141), T135 (≠ E142), Q136 (= Q143), Y156 (≠ W163), D157 (≠ A164), V158 (≠ R165), R159 (≠ S166), T195 (= T205), P196 (= P206), G217 (= G227), D219 (= D229), K223 (= K233), S290 (≠ L301), T291 (= T302), G292 (= G303)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
33% identity, 98% coverage: 3:325/330 of query aligns to 2:314/322 of O28608
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
30% identity, 98% coverage: 4:325/330 of query aligns to 1:320/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (= S86), T111 (= T116), G136 (= G141), V137 (≠ E142), Q138 (= Q143), D159 (≠ A164), I160 (≠ R165), A199 (≠ C204), T200 (= T205), T201 (≠ P206), A202 (≠ S207), V206 (≠ I211), V221 (≠ M226), G222 (= G227), W223 (≠ A228), S296 (≠ L301), V297 (≠ T302), G298 (= G303)
- binding proline: R39 (≠ I43), M54 (≠ K58), K67 (= K71), R110 (= R115)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
32% identity, 94% coverage: 4:313/330 of query aligns to 1:303/320 of A1B8Z0
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 94% coverage: 4:313/330 of query aligns to 3:305/322 of 6rqaB
- binding Tb-Xo4: E49 (≠ H51), D50 (≠ N52), N76 (= N78)
- binding nicotinamide-adenine-dinucleotide: T113 (= T116), G138 (= G141), Q140 (= Q143), P162 (≠ R165), H163 (≠ S166), I199 (≠ C204), T200 (= T205), S201 (≠ P206), S202 (= S207), M221 (= M226), G222 (= G227), D224 (= D229), K228 (= K233), G293 (≠ L301), T294 (= T302), G295 (= G303)
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 94% coverage: 4:313/330 of query aligns to 3:305/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ L87), T113 (= T116), G138 (= G141), H139 (≠ E142), Q140 (= Q143), N161 (≠ A164), P162 (≠ R165), H163 (≠ S166), M166 (≠ K169), I199 (≠ C204), T200 (= T205), S201 (≠ P206), S202 (= S207), M221 (= M226), G222 (= G227), D224 (= D229), K228 (= K233), G293 (≠ L301)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
30% identity, 97% coverage: 6:324/330 of query aligns to 7:314/314 of Q14894
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
30% identity, 94% coverage: 6:316/330 of query aligns to 6:306/312 of 2i99A
- active site: G59 (≠ D56), S228 (≠ D229)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (≠ N79), S90 (= S86), H91 (≠ L87), R118 (= R115), T119 (= T116), G142 (= G139), A143 (= A140), G144 (= G141), V145 (≠ E142), Q146 (= Q143), N167 (≠ A164), R168 (= R165), T169 (≠ S166), V203 (≠ C204), T204 (= T205), L205 (≠ P206), A206 (≠ S207), V225 (≠ M226), G226 (= G227), S291 (≠ L301), L292 (≠ T302), G293 (= G303)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
28% identity, 94% coverage: 6:316/330 of query aligns to 5:298/303 of 4bv9A
- active site: G58 (≠ D56), S220 (≠ D229)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (= S86), H83 (≠ L87), T111 (= T116), G134 (= G139), G136 (= G141), V137 (≠ E142), Q138 (= Q143), N159 (≠ A164), R160 (= R165), T161 (≠ S166), V195 (≠ C204), T196 (= T205), M197 (≠ P206), A198 (≠ S207), V217 (≠ M226), G218 (= G227), S283 (≠ L301), L284 (≠ T302), G285 (= G303)
- binding pyruvic acid: R45 (≠ I43), M60 (≠ K58), K73 (= K71), R110 (= R115)
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 77% coverage: 69:321/330 of query aligns to 69:323/325 of Q9FLY0
- G89 (= G89) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G139) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ V202) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
28% identity, 94% coverage: 6:316/330 of query aligns to 6:297/303 of 4bvaA
- active site: G59 (≠ D56), S219 (≠ D229)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T112), R109 (= R115), T110 (= T116), G135 (= G141), V136 (≠ E142), Q137 (= Q143), N158 (≠ A164), R159 (= R165), T160 (≠ S166), N163 (≠ K169), V194 (≠ C204), T195 (= T205), M196 (≠ P206), A197 (≠ S207), V216 (≠ M226), S282 (≠ L301), L283 (≠ T302), G284 (= G303)
- binding 3,5,3'triiodothyronine: R46 (≠ I43), F57 (≠ E54), G59 (≠ D56), V76 (≠ S73), F78 (= F76), S219 (≠ D229), R220 (≠ T230), W223 (≠ K233), E247 (= E260)
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
27% identity, 68% coverage: 105:329/330 of query aligns to 98:316/318 of 4mpdA
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
34% identity, 71% coverage: 3:236/330 of query aligns to 6:247/357 of 5gzlA
- binding lysine: G55 (≠ D47), E57 (= E50), I65 (≠ K58), E67 (≠ A60), D240 (= D229)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G75), T97 (≠ S86), I98 (≠ L87), T126 (= T116), G151 (= G141), A152 (≠ E142), Q153 (= Q143), D174 (≠ A164), T175 (≠ R165), H179 (≠ K169), A212 (≠ C204), T213 (= T205), S214 (≠ P206), V222 (≠ I211), V237 (≠ M226), G238 (= G227), A239 (= A228), D240 (= D229), K244 (= K233)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
34% identity, 71% coverage: 3:236/330 of query aligns to 2:243/344 of 5yu4A
- binding 2,4-diaminobutyric acid: E63 (≠ A60), K77 (= K71), R121 (= R115)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G75), T93 (≠ S86), I94 (≠ L87), R121 (= R115), T122 (= T116), G147 (= G141), A148 (≠ E142), Q149 (= Q143), D170 (≠ A164), T171 (≠ R165), H175 (≠ K169), A208 (≠ C204), T209 (= T205), S210 (≠ P206), V211 (vs. gap), V218 (≠ I211), V233 (≠ M226), A235 (= A228)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
34% identity, 71% coverage: 3:236/330 of query aligns to 2:243/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G75), T93 (≠ S86), I94 (≠ L87), T122 (= T116), G147 (= G141), A148 (≠ E142), Q149 (= Q143), D170 (≠ A164), T171 (≠ R165), A208 (≠ C204), T209 (= T205), S210 (≠ P206), V211 (vs. gap), V233 (≠ M226), A235 (= A228)
- binding proline: M65 (≠ L62), K77 (= K71), R121 (= R115)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
34% identity, 71% coverage: 3:236/330 of query aligns to 6:247/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G75), T97 (≠ S86), R125 (= R115), T126 (= T116), G151 (= G141), A152 (≠ E142), Q153 (= Q143), D174 (≠ A164), T175 (≠ R165), H179 (≠ K169), A212 (≠ C204), T213 (= T205), S214 (≠ P206), V215 (vs. gap), V237 (≠ M226), G238 (= G227), A239 (= A228)
- binding (2S)-piperidine-2-carboxylic acid: R53 (= R45), K81 (= K71), R125 (= R115), A239 (= A228)
Sites not aligning to the query:
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
25% identity, 99% coverage: 3:329/330 of query aligns to 2:332/334 of 4mp6A
- active site: I60 (≠ A60), M236 (≠ D229)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ S86), R120 (= R115), T121 (= T116), G146 (= G141), L147 (≠ E142), I148 (≠ Q143), D170 (vs. gap), Q171 (vs. gap), C211 (= C204), T212 (= T205), V213 (≠ P206), I233 (≠ M226), G306 (= G303)
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
28% identity, 79% coverage: 64:325/330 of query aligns to 61:316/340 of 1x7dA
- active site: D227 (= D229)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S86), R111 (= R115), T112 (= T116), G137 (= G141), A138 (≠ E142), Q139 (= Q143), D160 (≠ A164), T161 (≠ R165), V200 (≠ C204), T201 (= T205), A202 (≠ P206), I209 (= I211), V224 (≠ M226), G225 (= G227), D227 (= D229), K231 (= K233), S292 (≠ L301), V293 (≠ T302), G294 (= G303)
- binding L-ornithine: K68 (= K71), V70 (≠ S73), N71 (≠ P74), G72 (= G75), R111 (= R115), D227 (= D229), V293 (≠ T302)
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
26% identity, 68% coverage: 105:329/330 of query aligns to 105:308/310 of 4m54A
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
28% identity, 79% coverage: 64:325/330 of query aligns to 62:317/350 of Q88H32
Sites not aligning to the query:
Query Sequence
>PP_4431 FitnessBrowser__Putida:PP_4431
MSEVLLLNQREIRECVTLDTDSIDVVENAFASLARGKVVMPSILRLDISEHNGEVDVKTA
YLPDLENFAIKVSPGFFNNPGLGLPSLNGMMMLLSGRTGLLQALLLDNGYLTAVRTAAAG
AVAARWLARQDSEEVALLGAGEQAELQLKALLLVRDIKRVRVWARSSAKAQQLALQLSSL
YGLEATAAESVDEAMSSADIAVTCTPSNQPILHRRHLRPGLHITAMGADTEHKNEVAPEV
IAAVDHYVADRVSQTATLGELHHAINAGVAQDLRVYAELGQVILGDRVGRLTPTDVTLCD
LTGTGVQDTAIANLAFSRAISTGKGLLYNN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory