Comparing PP_4491 FitnessBrowser__Putida:PP_4491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q02I31 Putative pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
86% identity, 100% coverage: 1:118/118 of query aligns to 1:118/118 of Q02I31
2v6tB Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin (see paper)
30% identity, 78% coverage: 24:115/118 of query aligns to 11:100/100 of 2v6tB
P61459 Pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; DCoH; Dimerization cofactor of HNF1; Phenylalanine hydroxylase-stimulating protein; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 81% coverage: 16:111/118 of query aligns to 5:100/104 of P61459
Sites not aligning to the query:
P61457 Pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; DCoH; Dimerization cofactor of HNF1; Phenylalanine hydroxylase-stimulating protein; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Homo sapiens (Human) (see 6 papers)
30% identity, 81% coverage: 16:111/118 of query aligns to 5:100/104 of P61457
Sites not aligning to the query:
1f93A Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh (see paper)
30% identity, 81% coverage: 16:111/118 of query aligns to 4:99/103 of 1f93A
1dcpA Dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin (see paper)
33% identity, 66% coverage: 34:111/118 of query aligns to 20:95/99 of 1dcpA
>PP_4491 FitnessBrowser__Putida:PP_4491
MNALNQAHCEACRADAPKVTDEELAELIREIPDWNIEVRDGHMELERVFLFKNFKHALAF
TNAVGEIAEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMCARTDKVAETAEGRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory