SitesBLAST
Comparing PP_4632 FitnessBrowser__Putida:PP_4632 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
28% identity, 91% coverage: 17:240/245 of query aligns to 7:242/250 of 5bt9C
- active site: R18 (= R28), I140 (= I138), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R28), I19 (≠ V29), C38 (≠ A47), N39 (≠ S48), R40 (= R49), S41 (= S50), L66 (= L67), E67 (≠ A70), N90 (= N93), S92 (= S95), I140 (= I138), K159 (= K157), P184 (= P182), G185 (= G183), T187 (≠ L185), L188 (≠ I186)
5iz4A Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
28% identity, 71% coverage: 17:191/245 of query aligns to 3:199/247 of 5iz4A
- active site: G15 (≠ R28), S150 (≠ D140), S159 (= S149), Y163 (= Y153), K167 (= K157)
- binding adenosine-5'-diphosphate: G11 (= G24), S14 (≠ Q27), G15 (≠ R28), I16 (≠ V29), F36 (vs. gap), A63 (= A65), D64 (= D66), V65 (≠ L67), A92 (vs. gap), G93 (vs. gap), V117 (≠ L111)
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
25% identity, 89% coverage: 21:237/245 of query aligns to 13:253/260 of P50163
- 18:41 (vs. 26:49, 38% identical) binding
- S146 (≠ D140) binding
- IATSL 192:196 (≠ L---I 185:186) binding
2ae2A Tropinone reductase-ii complexed with NADP+ and pseudotropine (see paper)
25% identity, 89% coverage: 21:237/245 of query aligns to 12:252/259 of 2ae2A
- active site: G19 (≠ R28), S145 (≠ D140), Y158 (= Y153), K162 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G24), S17 (= S26), R18 (≠ Q27), G19 (≠ R28), I20 (≠ V29), S39 (= S48), R40 (= R49), C64 (≠ A65), L66 (= L67), N93 (= N93), G95 (≠ S95), I116 (≠ L111), I143 (= I138), S145 (≠ D140), Y158 (= Y153), K162 (= K157), P188 (= P182), G189 (= G183), V190 (≠ L184), I191 (≠ L185), T193 (vs. gap), S194 (vs. gap), L195 (≠ I186), V196 (≠ L187)
- binding pseudotropine: S145 (≠ D140), E155 (≠ H150), Y158 (= Y153), L195 (≠ I186)
1ipfA Tropinone reductase-ii complexed with NADPH and tropinone (see paper)
25% identity, 89% coverage: 21:237/245 of query aligns to 12:252/259 of 1ipfA
- active site: G19 (≠ R28), S145 (≠ D140), Y158 (= Y153), K162 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G24), R18 (≠ Q27), G19 (≠ R28), I20 (≠ V29), S39 (= S48), R40 (= R49), C64 (≠ A65), D65 (= D66), L66 (= L67), N93 (= N93), S145 (≠ D140), Y158 (= Y153), K162 (= K157), P188 (= P182), V190 (≠ L184), I191 (≠ L185), T193 (vs. gap), S194 (vs. gap), L195 (≠ I186), V196 (≠ L187)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: S147 (≠ T142), E155 (≠ H150), Y158 (= Y153)
1ipeA Tropinone reductase-ii complexed with NADPH (see paper)
25% identity, 89% coverage: 21:237/245 of query aligns to 12:252/259 of 1ipeA
- active site: G19 (≠ R28), S145 (≠ D140), Y158 (= Y153), K162 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G24), S17 (= S26), R18 (≠ Q27), G19 (≠ R28), I20 (≠ V29), S39 (= S48), R40 (= R49), C64 (≠ A65), D65 (= D66), L66 (= L67), N93 (= N93), I116 (≠ L111), S145 (≠ D140), Y158 (= Y153), K162 (= K157), P188 (= P182), I191 (≠ L185), T193 (vs. gap), S194 (vs. gap), L195 (≠ I186), V196 (≠ L187)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
28% identity, 91% coverage: 16:238/245 of query aligns to 3:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G24), S13 (= S26), R14 (≠ Q27), G15 (≠ R28), I16 (≠ V29), L36 (vs. gap), R37 (vs. gap), N38 (vs. gap), A61 (= A65), D62 (= D66), V63 (≠ L67), N89 (= N93), A90 (= A94), G91 (≠ S95), T113 (≠ L119), V143 (≠ I138), S145 (≠ D140), Y159 (= Y153), K163 (= K157), P189 (= P182), G190 (= G183), I192 (≠ L185), T194 (vs. gap), I196 (= I186), H197 (≠ L187)
4bo8A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(2-amino-4- phenylimidazol-1-yl)-3-(2-fluorophenyl)urea at 2.7a resolution (see paper)
27% identity, 90% coverage: 21:241/245 of query aligns to 11:236/236 of 4bo8A
4bo2A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(1-ethylbenzimidazol-2- yl)-3-(2-methoxyphenyl)urea at 1.9a resolution (see paper)
27% identity, 90% coverage: 21:241/245 of query aligns to 13:238/238 of 4bo2A
4bo0A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(4-methoxy-1- methylindazol-3-yl)-3-(2-methoxyphenyl)urea at 2.4a resolution (see paper)
27% identity, 90% coverage: 21:241/245 of query aligns to 10:235/235 of 4bo0A
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
24% identity, 92% coverage: 16:240/245 of query aligns to 3:246/246 of 3osuA
3jq8A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6,7,7- trimethyl-7,8-dihydropteridine-2,4-diamine (dx3) (see paper)
25% identity, 90% coverage: 21:240/245 of query aligns to 6:245/248 of 3jq8A
- active site: R13 (= R28), D142 (= D140), Y155 (= Y153), K159 (= K157)
- binding 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine: S94 (= S95), F96 (≠ W97), Y155 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R28), I14 (≠ V29), H32 (vs. gap), Y33 (vs. gap), H34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D61 (= D66), L62 (= L67), N92 (= N93), A93 (= A94), S94 (= S95), T116 (≠ L111), C141 (= C139), D142 (= D140), K159 (= K157), P185 (= P182), G186 (= G183), S188 (≠ L185)
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
26% identity, 90% coverage: 21:240/245 of query aligns to 11:239/239 of 4bnxA
- active site: G18 (≠ R28), S134 (≠ D140), Y147 (= Y153), K151 (= K157)
- binding 6-[4-(2-chloroanilino)-1H-quinazolin-2-ylidene]cyclohexa-2,4-dien-1-one: V103 (≠ L105), N104 (≠ E106), L107 (≠ V113), A149 (= A155), G153 (≠ A159), G156 (≠ N162), F157 (≠ M163)
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
26% identity, 90% coverage: 21:240/245 of query aligns to 10:238/239 of 4bnyA
4bo5A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-chlorophenyl)-4- pyrrol-1-yl-1,3,5-triazin-2-amine at 2.6a resolution (see paper)
25% identity, 90% coverage: 21:241/245 of query aligns to 14:236/236 of 4bo5A
- active site: G21 (≠ R28), S139 (≠ D140), Y152 (= Y153), K156 (= K157)
- binding N-(2-chlorophenyl)-4-pyrrol-1-yl-1,3,5-triazin-2-amine: W104 (≠ L105), F105 (≠ E106), V108 (≠ F109), A154 (= A155), A157 (= A158), G158 (≠ A159)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
26% identity, 91% coverage: 14:237/245 of query aligns to 2:236/240 of 4dmmB
- active site: G16 (≠ R28), S142 (≠ D140), Q152 (≠ H150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G24), S14 (= S26), R15 (≠ Q27), G16 (≠ R28), I17 (≠ V29), A37 (vs. gap), S38 (vs. gap), S39 (vs. gap), A62 (= A65), D63 (= D66), V64 (≠ L67), N90 (= N93), A91 (= A94), L113 (= L111), I140 (= I138), S142 (≠ D140), Y155 (= Y153), K159 (= K157), P185 (= P182), G186 (= G183), I188 (≠ L185), T190 (= T199), M192 (≠ K201)
3gn1C Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (ddd00067116) (see paper)
26% identity, 90% coverage: 21:240/245 of query aligns to 6:245/248 of 3gn1C
- active site: R13 (= R28), D141 (= D140), Y154 (= Y153), K158 (= K157)
- binding 1H-benzimidazol-2-amine: F96 (≠ W97), Y154 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R28), I14 (≠ V29), H32 (vs. gap), Y33 (vs. gap), H34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D61 (= D66), L62 (= L67), N92 (= N93), A93 (= A94), S94 (= S95), T116 (≠ L111), L139 (≠ I138), C140 (= C139), D141 (= D140), K158 (= K157), P184 (= P182), G185 (= G183), V186 (≠ L184), S187 (≠ L185)
4bo6A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2,3-dihydroindol-1-yl-(2- thiophen-3-yl-1,3-thiazol-4-yl)methanone at 2.8a resolution (see paper)
27% identity, 90% coverage: 21:241/245 of query aligns to 11:233/233 of 4bo6A
- active site: G18 (≠ R28), S130 (= S143), Y140 (= Y153), K144 (= K157)
- binding 2,3-dihydroindol-1-yl-(2-thiophen-3-yl-1,3-thiazol-4-yl)methanone: F96 (≠ L98), V99 (≠ G101), N100 (≠ L102), L103 (= L105), G149 (≠ N162), F150 (≠ M163)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
27% identity, 90% coverage: 21:240/245 of query aligns to 5:244/245 of 4k6fB
- active site: G12 (≠ R28), N102 (= N104), S138 (≠ D140), Y151 (= Y153), K155 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G24), Y32 (vs. gap), S33 (vs. gap), N36 (vs. gap), V58 (≠ A65), D59 (= D66), V60 (≠ L67), A87 (= A94), G88 (≠ S95), I89 (≠ L96)
3bmqA Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (compound ax5) (see paper)
26% identity, 90% coverage: 21:240/245 of query aligns to 6:250/253 of 3bmqA
- active site: R13 (= R28), D146 (= D140), Y159 (= Y153), K163 (= K157)
- binding 6-(benzylsulfanyl)pyrimidine-2,4-diamine: S94 (= S95), F96 (≠ W97), Y159 (= Y153), L193 (≠ I186), P195 (≠ K188), M198 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R28), I14 (≠ V29), Y33 (vs. gap), H34 (vs. gap), N35 (vs. gap), S36 (vs. gap), L62 (= L67), N92 (= N93), A93 (= A94), S94 (= S95), T117 (≠ L111), L144 (≠ I138), K163 (= K157), P189 (= P182), G190 (= G183), S192 (≠ L185), L193 (≠ I186)
Query Sequence
>PP_4632 FitnessBrowser__Putida:PP_4632
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSIQPQAAHPNI
VQFQADLCQAGDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDDAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory