SitesBLAST
Comparing PP_4757 FitnessBrowser__Putida:PP_4757 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
73% identity, 98% coverage: 9:448/448 of query aligns to 6:446/446 of P0AES2
- Y150 (= Y153) mutation to F: Reduces activity 100-fold.
- K207 (= K210) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D238) binding
- E266 (= E269) binding
- N289 (= N292) binding
- H339 (= H342) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N344) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D369) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
73% identity, 98% coverage: 9:448/448 of query aligns to 2:442/442 of 1ec8A
- active site: K201 (= K208), K203 (= K210), D231 (= D238), N233 (= N240), E256 (= E263), N285 (= N292), M286 (= M293), D309 (= D316), H335 (= H342), N337 (= N344), I361 (= I368)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N30), H28 (= H35), T99 (= T106), Y146 (= Y153), K203 (= K210), D231 (= D238), N233 (= N240), N285 (= N292), H335 (= H342), S336 (= S343), N337 (= N344), H364 (= H371), R418 (= R424)
- binding magnesium ion: D231 (= D238), E256 (= E263), N285 (= N292)
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
73% identity, 98% coverage: 9:448/448 of query aligns to 4:444/444 of 1ecqA
- active site: K203 (= K208), K205 (= K210), D233 (= D238), N235 (= N240), E258 (= E263), N287 (= N292), M288 (= M293), D311 (= D316), H337 (= H342), N339 (= N344), I363 (= I368)
- binding 4-deoxyglucarate: N25 (= N30), H30 (= H35), T101 (= T106), Y148 (= Y153), F150 (= F155), K205 (= K210), D233 (= D238), N235 (= N240), N287 (= N292), H337 (= H342), S338 (= S343), N339 (= N344), H366 (= H371), R420 (= R424)
- binding magnesium ion: D233 (= D238), E258 (= E263), N287 (= N292)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
73% identity, 98% coverage: 9:448/448 of query aligns to 4:444/444 of 1ec9D
- active site: K203 (= K208), K205 (= K210), D233 (= D238), N235 (= N240), E258 (= E263), N287 (= N292), M288 (= M293), D311 (= D316), H337 (= H342), N339 (= N344), I363 (= I368)
- binding magnesium ion: D233 (= D238), E258 (= E263), N287 (= N292)
- binding xylarohydroxamate: H30 (= H35), T101 (= T106), Y148 (= Y153), F150 (= F155), K205 (= K210), D233 (= D238), N235 (= N240), N287 (= N292), H337 (= H342), S338 (= S343), N339 (= N344), H366 (= H371), R420 (= R424)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
72% identity, 98% coverage: 9:448/448 of query aligns to 3:443/443 of 1jctA
- active site: K202 (= K208), K204 (= K210), D232 (= D238), N234 (= N240), E257 (= E263), N286 (= N292), M287 (= M293), D310 (= D316), H336 (= H342), L338 (≠ N344), I362 (= I368)
- binding d-glucarate: N24 (= N30), H29 (= H35), T100 (= T106), Y147 (= Y153), F149 (= F155), K204 (= K210), D232 (= D238), N286 (= N292), S337 (= S343), R419 (= R424)
- binding magnesium ion: D232 (= D238), E257 (= E263), N286 (= N292)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
68% identity, 98% coverage: 10:446/448 of query aligns to 2:428/428 of 3p0wB
- active site: K189 (= K208), K191 (= K210), D219 (= D238), N221 (= N240), E244 (= E263), N273 (= N292), D297 (= D316), H323 (= H342), N325 (= N344)
- binding d-glucarate: H27 (= H35), Y134 (= Y153), K191 (= K210), D219 (= D238), N221 (= N240), N273 (= N292), H323 (= H342), N325 (= N344), H352 (= H371), R406 (= R424)
- binding magnesium ion: D219 (= D238), E244 (= E263), N273 (= N292)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
68% identity, 98% coverage: 10:446/448 of query aligns to 2:424/425 of 3nxlC
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
61% identity, 98% coverage: 11:447/448 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K208), K203 (= K210), D231 (= D238), N233 (= N240), E256 (= E263), N285 (= N292), D309 (= D316), H335 (= H342), N337 (= N344)
- binding magnesium ion: D231 (= D238), N233 (= N240), E256 (= E263), D257 (= D264), N285 (= N292)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
60% identity, 98% coverage: 9:448/448 of query aligns to 2:430/432 of 3n6hB
- active site: K189 (= K208), K191 (= K210), D219 (= D238), N221 (= N240), E244 (= E263), N273 (= N292), D297 (= D316), H323 (= H342), N325 (= N344)
- binding magnesium ion: D219 (= D238), E244 (= E263), N273 (= N292)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
59% identity, 98% coverage: 9:448/448 of query aligns to 1:426/426 of 3pfrA
- active site: K185 (= K208), K187 (= K210), D215 (= D238), N217 (= N240), E240 (= E263), N269 (= N292), D293 (= D316), H319 (= H342), N321 (= N344)
- binding d-glucarate: N22 (= N30), H27 (= H35), Y130 (= Y153), F132 (= F155), K187 (= K210), D215 (= D238), N217 (= N240), N269 (= N292), H319 (= H342), S320 (= S343), N321 (= N344), H348 (= H371)
- binding magnesium ion: D215 (= D238), E240 (= E263), N269 (= N292)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
37% identity, 95% coverage: 13:438/448 of query aligns to 6:421/427 of 4it1D
- active site: S51 (≠ V58), D54 (≠ G61), A98 (≠ R102), Y150 (= Y153), K194 (= K208), K196 (= K210), D224 (= D238), N226 (= N240), Y247 (= Y261), E249 (= E263), T271 (= T291), N272 (= N292), M273 (= M293), D296 (= D316), H323 (= H342), S324 (= S343), N325 (= N344), C349 (≠ I368), D350 (= D369)
- binding magnesium ion: D224 (= D238), E249 (= E263), N272 (= N292)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
34% identity, 97% coverage: 12:444/448 of query aligns to 12:425/427 of 3va8A
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
36% identity, 96% coverage: 12:443/448 of query aligns to 3:417/420 of 3vc6A
- active site: D52 (≠ G61), H55 (vs. gap), Y146 (= Y153), K188 (= K208), K190 (= K210), D218 (= D238), N220 (= N240), E243 (= E263), N266 (= N292), M267 (= M293), D290 (= D316), H317 (= H342), S318 (= S343), N319 (= N344), H321 (= H346), C343 (≠ I368), D344 (= D369)
- binding magnesium ion: D218 (= D238), E243 (= E263), N266 (= N292)
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
26% identity, 66% coverage: 115:410/448 of query aligns to 98:361/366 of 3dg6A
- active site: M134 (= M150), K160 (= K208), K162 (= K210), D191 (= D238), N193 (= N240), E217 (= E263), D242 (≠ A284), E243 (≠ T285), S244 (≠ G286), K266 (≠ Q308), G292 (≠ N344), N293 (= N345), Q294 (≠ H346), G319 (≠ I368), E320 (≠ D369), L321 (≠ T370)
- binding magnesium ion: D191 (= D238), E217 (= E263), D242 (≠ A284)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (= M150), K160 (= K208), K162 (= K210), D191 (= D238), N193 (= N240), D242 (≠ A284), K266 (≠ Q308), N293 (= N345), Q294 (≠ H346), I295 (≠ F347)
Sites not aligning to the query:
3u4fA Crystal structure of a mandelate racemase (muconate lactonizing enzyme family protein) from roseovarius nubinhibens
26% identity, 67% coverage: 115:412/448 of query aligns to 86:364/371 of 3u4fA
- active site: S122 (≠ D159), K150 (= K208), R152 (≠ K210), D162 (≠ E218), D188 (= D238), N190 (= N240), F213 (≠ A262), E214 (= E263), D235 (≠ R283), G239 (≠ L287), E240 (≠ P288), Q261 (≠ D316), D263 (≠ H318), H290 (= H342), A292 (≠ N344), N293 (= N345), K313 (≠ E364), E316 (≠ A367), I319 (vs. gap), G321 (vs. gap)
- binding magnesium ion: D188 (= D238), E214 (= E263), S229 (≠ M278), L232 (≠ F281), E240 (≠ P288)
Sites not aligning to the query:
2gghC The mutant a68c-d72c-nlq of deinococcus radiodurans nacylamino acid racemase (see paper)
26% identity, 72% coverage: 92:415/448 of query aligns to 80:364/370 of 2gghC
- active site: Y95 (≠ F107), S137 (≠ R168), K163 (= K208), K165 (= K210), R186 (= R234), T188 (= T236), D190 (= D238), N192 (= N240), E215 (= E263), D240 (≠ P288), E241 (≠ T289), S242 (≠ A290), K264 (≠ Q308), C290 (vs. gap), G291 (vs. gap), G292 (vs. gap), M293 (vs. gap), G316 (= G363), D317 (≠ E364), T318 (≠ I365)
- binding magnesium ion: D190 (= D238), E215 (= E263)
- binding n~2~-acetyl-l-glutamine: G292 (vs. gap), M293 (vs. gap), L294 (vs. gap)
Sites not aligning to the query:
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
27% identity, 83% coverage: 42:411/448 of query aligns to 31:361/364 of 3i6tB
- active site: S136 (≠ Y156), K161 (= K199), K163 (≠ R201), D191 (= D238), N193 (= N240), E217 (= E263), D242 (≠ N292), E243 (≠ M293), S262 (≠ D311), K264 (≠ P313), G291 (≠ N344), D292 (≠ N345), M293 (≠ H346), C317 (vs. gap), E318 (vs. gap), F319 (vs. gap)
- binding magnesium ion: D191 (= D238), E217 (= E263), D242 (≠ N292)
Sites not aligning to the query:
3ugvF Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
24% identity, 77% coverage: 68:410/448 of query aligns to 64:359/364 of 3ugvF
- active site: A95 (= A100), S137 (= S173), K168 (= K208), R170 (≠ K210), D199 (= D238), N201 (= N240), E225 (= E263), G250 (≠ N292), E251 (≠ M293), N252 (≠ I294), M272 (≠ L314), D274 (= D316), A293 (≠ D334), H301 (= H342), L302 (≠ S343), Y303 (≠ N344), E321 (vs. gap)
- binding magnesium ion: D199 (= D238), E225 (= E263), R240 (= R282), L243 (≠ T285), E251 (≠ M293)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
24% identity, 66% coverage: 111:404/448 of query aligns to 103:356/373 of 3cb3A
- active site: T143 (vs. gap), K171 (= K208), K173 (= K210), D202 (= D238), N204 (= N240), E228 (= E263), G253 (≠ N292), E254 (≠ M293), M275 (≠ L314), D277 (= D316), H304 (= H342), F305 (≠ I349), A306 (≠ S350), E324 (≠ I368)
- binding l-glucaric acid: K171 (= K208), K173 (= K210), D202 (= D238), E254 (≠ M293), H304 (= H342)
- binding magnesium ion: D202 (= D238), E228 (= E263), A243 (≠ M278), F246 (= F281), E254 (≠ M293)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
24% identity, 66% coverage: 111:405/448 of query aligns to 92:346/363 of 2og9A
- active site: T132 (vs. gap), K160 (= K208), K162 (= K210), D191 (= D238), N193 (= N240), E217 (= E263), G242 (≠ N292), E243 (≠ M293), M264 (≠ L314), D266 (= D316), H293 (= H342), F294 (≠ I349), A295 (≠ S350), E313 (≠ I368)
- binding calcium ion: A232 (≠ M278), F235 (= F281)
Sites not aligning to the query:
Query Sequence
>PP_4757 FitnessBrowser__Putida:PP_4757
MNMQTLHTSTPVVTDLRVVPVAGHDSMLLNLSGAHGPFFTRNVVVLRDSAGNTGLGEVPG
GEKIRQTLEDARSLVVGQPIGHYQRVLNAMRQTFANRDSAGRGLQTFDLRITVHAVTAIE
SALLDLLGQHLNVPMAALLGEGQQRDAVKMLGYLFYIGDRQQTDLAYRNEADSDDDWFRL
RHEKALTPEAVVRLAEAAKARYGFSDFKLKGGVLRGEEEMEAVTALAERFPEARITLDPN
GAWSLKEAIALCRDKHNVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDWRQ
MGHAIQLQSVDIPLADPHFWTLQGSVRVAQMCNDWGLTWGSHSNNHFDISLAMFTQVAAA
APGEITAIDTHWIWQDGQRLTREPLRIVDGHVRVPARPGLGVELDEDQLAKAHECYRNMG
LGARDDSVAMQFLIPGWSFDNKRPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory