SitesBLAST
Comparing PP_5257 FitnessBrowser__Putida:PP_5257 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
24% identity, 82% coverage: 35:390/432 of query aligns to 28:386/824 of Q8GAI3
- W66 (≠ G72) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R73) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 86% coverage: 31:400/432 of query aligns to 23:379/383 of 5i39A
- active site: F66 (≠ N74), Q69 (≠ N79), A70 (= A80), Q248 (vs. gap), P267 (≠ D285)
- binding flavin-adenine dinucleotide: V30 (≠ I38), G31 (= G39), G33 (= G41), I34 (= I42), L35 (≠ T43), V53 (≠ L61), E54 (= E62), K55 (≠ A63), Q62 (≠ G70), S63 (= S71), F66 (≠ N74), Y67 (≠ V75), Q69 (≠ N79), A196 (≠ S211), A197 (≠ V212), G226 (≠ T240), G227 (= G241), W229 (= W248), Q248 (vs. gap), Q250 (vs. gap), G321 (= G343), M323 (≠ I345), T348 (≠ N369), G349 (= G370), W350 (≠ R371), G351 (= G372), M352 (≠ N373), T353 (= T374)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
25% identity, 51% coverage: 32:252/432 of query aligns to 16:230/433 of 5hxwA
- active site: F58 (≠ N74), Q61 (≠ N79), A62 (= A80)
- binding flavin-adenine dinucleotide: V22 (≠ I38), G23 (= G39), G25 (= G41), I26 (= I42), L27 (≠ T43), E46 (= E62), K47 (≠ A63), E53 (≠ G69), Q54 (≠ G70), S55 (= S71), R57 (= R73), F58 (≠ N74), Y59 (≠ V75), G60 (= G76), Q61 (≠ N79), A188 (≠ S211), A189 (≠ V212), G218 (≠ T240), G219 (= G241), W221 (≠ Y243)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
23% identity, 91% coverage: 9:401/432 of query aligns to 27:429/866 of Q9UI17
- CV 59:60 (≠ IT 42:43) binding
- EK 80:81 (≠ EA 62:63) binding
- 87:95 (vs. 69:77, 33% identical) binding
- H91 (≠ R73) modified: Tele-8alpha-FAD histidine
- H109 (≠ L105) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V212) binding
- S279 (≠ Q269) to P: in dbSNP:rs532964
- F-GYGII 397:402 (≠ YNGRGNT 368:374) binding
Sites not aligning to the query:
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
25% identity, 82% coverage: 32:387/432 of query aligns to 1:344/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I38), G8 (= G39), G10 (= G41), V11 (≠ I42), I12 (≠ T43), V30 (≠ L61), E31 (= E62), K32 (≠ A63), E38 (≠ G69), A39 (≠ G70), S40 (= S71), A43 (≠ N74), G45 (= G76), L46 (= L77), V171 (= V212), G200 (≠ T240), G201 (= G241), W203 (≠ Y243), G298 (= G343), R300 (≠ D346), P301 (≠ F347), Y326 (≠ N369), R327 (≠ G370), N328 (≠ R371), G329 (= G372), I330 (≠ N373)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 49% coverage: 32:241/432 of query aligns to 42:242/857 of Q63342
- CV 52:53 (≠ IT 42:43) binding
- EK 73:74 (≠ EA 62:63) binding
- 80:88 (vs. 69:77, 33% identical) binding
- H84 (≠ R73) modified: Tele-8alpha-FAD histidine
- V212 (= V212) binding
Sites not aligning to the query:
- 244 binding
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 49% coverage: 32:241/432 of query aligns to 5:205/824 of 4pabB
- active site: T53 (= T82), E102 (≠ D142)
- binding flavin-adenine dinucleotide: I11 (= I38), G12 (= G39), G14 (= G41), C15 (≠ I42), V16 (≠ T43), L35 (= L61), E36 (= E62), K37 (≠ A63), G43 (= G69), S44 (≠ G70), T45 (≠ S71), H47 (≠ R73), A48 (≠ N74), A49 (≠ V75), G50 (= G76), L51 (= L77), V175 (= V212), A204 (≠ T240), G205 (= G241)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
24% identity, 85% coverage: 34:400/432 of query aligns to 21:383/403 of 2gagB
- active site: A61 (≠ G72), T64 (≠ V75), T65 (≠ G76)
- binding flavin-adenine dinucleotide: G26 (= G39), G28 (= G41), G29 (≠ I42), H30 (≠ T43), E51 (= E62), K52 (≠ A63), G58 (= G69), N59 (≠ G70), M60 (≠ S71), R62 (= R73), N63 (= N74), T64 (≠ V75), I66 (≠ L77), V195 (= V212), G224 (≠ T240), A225 (≠ G241), H227 (≠ Y243), L231 (= L251), L246 (= L268), G352 (= G370), T353 (≠ R371), G354 (= G372), G355 (≠ N373), F356 (≠ T374), K357 (≠ T375)
- binding flavin mononucleotide: A61 (≠ G72), R62 (= R73), H171 (≠ P188), V250 (≠ A272), E278 (≠ R300), R321 (≠ M339), W323 (= W341)
- binding 2-furoic acid: T64 (≠ V75), I66 (≠ L77), R68 (≠ N79), M263 (≠ D285), Y270 (≠ S292), K357 (≠ T375)
- binding sulfite ion: K170 (≠ N187), K276 (≠ Q298)
Sites not aligning to the query:
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
24% identity, 66% coverage: 117:400/432 of query aligns to 94:385/405 of P40875
- C146 (= C169) mutation to S: No change in activity.
- H173 (≠ P188) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ G190) mutation to A: No effect on FMN binding and activity.
- C195 (≠ S210) mutation to S: No change in activity.
- C351 (≠ T366) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
23% identity, 65% coverage: 122:400/432 of query aligns to 98:384/402 of 1vrqB
- active site: G326 (= G343), K358 (≠ T375)
- binding n,n-dimethylglycine: K358 (≠ T375)
- binding flavin-adenine dinucleotide: V196 (= V212), A224 (≠ S239), G225 (≠ T240), H228 (≠ Y243), L247 (= L268), G353 (= G370), T354 (≠ R371), G355 (= G372), G356 (≠ N373), F357 (≠ T374), K358 (≠ T375)
- binding flavin mononucleotide: H172 (≠ P188), V251 (≠ A272), E279 (≠ R300), R322 (≠ M339), W324 (= W341)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
23% identity, 65% coverage: 122:400/432 of query aligns to 98:384/404 of 3ad8B
- active site: G326 (= G343), K358 (≠ T375)
- binding flavin-adenine dinucleotide: V196 (= V212), G225 (≠ T240), A226 (≠ G241), H228 (≠ Y243), L247 (= L268), G353 (= G370), T354 (≠ R371), G355 (= G372), G356 (≠ N373), F357 (≠ T374), K358 (≠ T375)
- binding flavin mononucleotide: H172 (≠ P188), V251 (≠ A272), E279 (≠ R300), R322 (≠ M339), W324 (= W341)
- binding pyrrole-2-carboxylate: M264 (≠ D285), Y271 (≠ S292), T354 (≠ R371), K358 (≠ T375)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
23% identity, 65% coverage: 122:400/432 of query aligns to 98:384/404 of 3ad7B
- active site: G326 (= G343), K358 (≠ T375)
- binding flavin-adenine dinucleotide: V196 (= V212), G225 (≠ T240), A226 (≠ G241), H228 (≠ Y243), L247 (= L268), G353 (= G370), T354 (≠ R371), G355 (= G372), G356 (≠ N373), F357 (≠ T374), K358 (≠ T375)
- binding flavin mononucleotide: H172 (≠ P188), V251 (≠ A272), K277 (≠ Q298), E279 (≠ R300), R322 (≠ M339), W324 (= W341)
- binding [methylthio]acetate: M264 (≠ D285), Y271 (≠ S292), T354 (≠ R371), K358 (≠ T375)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
23% identity, 65% coverage: 122:400/432 of query aligns to 99:385/405 of Q50LF2
- K172 (≠ N187) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ P188) modified: Tele-8alpha-FMN histidine
- V197 (= V212) binding
- H270 (≠ L290) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ S292) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G370) binding
- G357 (≠ N373) binding
- K359 (≠ T375) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
22% identity, 51% coverage: 50:270/432 of query aligns to 22:224/364 of 3if9A
- active site: A47 (≠ V75), G48 (= G76), M49 (≠ L77)
- binding flavin-adenine dinucleotide: E34 (= E62), S35 (≠ A63), T42 (≠ G70), T43 (≠ S71), A46 (≠ N74), A47 (≠ V75), G48 (= G76), M49 (≠ L77), P173 (≠ S211), V174 (= V212), S202 (≠ T240), G203 (= G241), W205 (= W248), F209 (= F255)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 13, 15, 300, 302, 327, 328, 329, 330, 331, 332
- binding glycolic acid: 246, 302, 329
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
22% identity, 51% coverage: 50:270/432 of query aligns to 22:224/364 of 1ng3A
- active site: A47 (≠ V75), G48 (= G76), M49 (≠ L77)
- binding flavin-adenine dinucleotide: F33 (≠ L61), E34 (= E62), S35 (≠ A63), R41 (≠ G69), T42 (≠ G70), T43 (≠ S71), A46 (≠ N74), A47 (≠ V75), G48 (= G76), M49 (≠ L77), V174 (= V212), S202 (≠ T240), G203 (= G241), W205 (= W248), F209 (= F255)
- binding phosphate ion: R89 (≠ Q124)
Sites not aligning to the query:
- binding acetylamino-acetic acid: 246, 302, 329
- binding flavin-adenine dinucleotide: 11, 13, 15, 300, 302, 327, 329, 330, 331, 332
- binding phosphate ion: 254
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
22% identity, 51% coverage: 50:270/432 of query aligns to 22:224/369 of O31616
- ES 34:35 (≠ EA 62:63) binding
- TT 42:43 (≠ GS 70:71) binding
- AGM 47:49 (≠ VGL 75:77) binding
- G51 (≠ N79) mutation to R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; mutation to S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- A54 (≠ T82) mutation to R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- V174 (= V212) binding
Sites not aligning to the query:
- 14:15 binding
- 244 H→A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- 302 binding
- 327:333 binding
- 329 binding
Query Sequence
>PP_5257 FitnessBrowser__Putida:PP_5257
MEPAMSELRQQCLWEHVSKPTVAAQALAGEHKADVCVIGGGITGLSAAIHLLEQGKSVIV
LEAWKIGHGGSGRNVGLVNAGTWIRPDDVEATLGQKQGSRLNKVLGEAPAEVFAMIERLG
IDCQAQHKGTLHMAHNATGIADLEARHEQWRRRGADVELLTGAQCQEYCGTDKISAALLD
RRAGTINPMGYTQGLAAAVTRLGGKIFQQSSVEGLEREGDGWRVKTARGAVRAEKVVIST
GAYTEGDWSNLQKQFFRGYYYQVASKPLQGIAADKVLPHGQGSWDTRTVLSSIRRDDQGR
LLLGSLGRVDNKPAWFVRSWADRIQSHYYPELGKVEWEMHWTGCIDFTPDHLMRLFEPAP
GLVAVTGYNGRGNTTGTVIGRAFAEFLLKGEADSLPIPFSPMSGVSAPSLRTAFYESGFS
LYHAGQCLRVVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory