SitesBLAST
Comparing Pf1N1B4_4198 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4198 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
48% identity, 96% coverage: 4:432/445 of query aligns to 10:440/448 of Q51955
- D41 (= D35) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D38) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G79) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D83) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G86) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R118) mutation to A: Abolishes 4-HBA transport.
- E144 (= E138) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ Q177) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D315) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ N320) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R378) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R390) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
42% identity, 96% coverage: 3:429/445 of query aligns to 2:428/452 of Q5EXK5
- D82 (= D83) mutation to A: Loss of activity.
- V311 (≠ W312) mutation to W: Loss of activity.
- D314 (= D315) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
36% identity, 94% coverage: 23:439/445 of query aligns to 15:398/403 of P77589
- E27 (≠ D35) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D83) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ W312) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R316) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
28% identity, 86% coverage: 29:410/445 of query aligns to 48:406/444 of Q8NLB7
- D54 (= D35) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D38) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R84) mutation to A: Loss of transport activity.
- W309 (= W312) mutation to V: Loss of transport activity.
- D312 (= D315) mutation to A: Loss of transport activity.
- R313 (= R316) mutation to A: Loss of transport activity.
- I317 (≠ N320) mutation I->H,Y: Loss of transport activity.
- R386 (= R390) mutation to A: Loss of transport activity.
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
25% identity, 79% coverage: 48:400/445 of query aligns to 101:448/497 of 8bw7A
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
25% identity, 79% coverage: 48:400/445 of query aligns to 113:470/545 of Q8VC69
- C122 (vs. gap) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C183 (≠ A115) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C434 (≠ G364) mutation to A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
24% identity, 79% coverage: 48:400/445 of query aligns to 101:452/502 of 8bvsA
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
24% identity, 79% coverage: 48:400/445 of query aligns to 110:461/508 of 8bvtA
Sites not aligning to the query:
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
21% identity, 68% coverage: 12:315/445 of query aligns to 5:301/430 of P0AA76
- Y29 (≠ G36) binding
- D31 (= D38) mutation to N: Loss of galactonate transport activity.
- R32 (≠ V39) binding
- Y64 (≠ L71) binding
- E118 (≠ L125) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
25% identity, 84% coverage: 35:407/445 of query aligns to 115:484/557 of O76082
- D115 (= D35) to G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
- V123 (≠ G43) to G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
- E131 (= E52) to D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
- A142 (≠ G61) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
- P143 (= P62) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
- L144 (≠ V63) to F: in dbSNP:rs10040427
- V151 (= V69) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
- R169 (= R87) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
- V175 (≠ T93) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
- M177 (≠ V95) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
- M179 (vs. gap) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
- L186 (= L101) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
- M205 (≠ V123) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
- N210 (≠ A128) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
- Y211 (≠ L129) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
- A214 (≠ T132) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
- T219 (≠ S137) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
- S225 (≠ R143) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
- R227 (= R145) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
- F230 (= F148) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
- S231 (≠ I149) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
- T232 (= T150) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
- A240 (≠ M158) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
- G242 (≠ S160) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
- P247 (≠ F165) to R: in CDSP; loss of carnitine transport
- R254 (≠ H174) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
- R257 (≠ Q177) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
- T264 (≠ I185) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
- L269 (= L190) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
- S280 (= S201) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
- R282 (= R203) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
- W283 (≠ F204) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
- A301 (≠ N220) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
- I312 (≠ K231) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
- E317 (≠ A239) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
- I348 (≠ T274) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
- W351 (= W277) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
- M352 (= M278) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
- S355 (≠ L281) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
- Y358 (≠ E284) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
- L363 (≠ I289) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
- L394 (≠ D315) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
- P398 (= P319) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
- R399 (≠ N320) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
- S412 (≠ A332) to G: in CDSP; uncertain significance; no effect on carnitine transport
- V439 (≠ M358) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
- T440 (≠ S359) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
- A442 (= A361) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
- F443 (≠ Q362) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
- V446 (≠ L365) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
- Y447 (≠ N366) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
- V448 (≠ A367) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
- Y449 (≠ F368) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
- E452 (≠ G371) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
- P455 (= P374) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
- G462 (= G381) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
- S467 (≠ R390) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
- T468 (≠ F391) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
- S470 (≠ A393) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
- R471 (≠ I394) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
- L476 (≠ I399) to R: in CDSP; loss of carnitine transport
- P478 (≠ G401) to L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735
- V481 (≠ L404) to F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; to I: in dbSNP:rs11568513
Sites not aligning to the query:
- 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
- 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
- 16 P → L: in CDSP; loss of carnitine transport
- 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
- 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
- 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
- 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
- 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
- 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
- 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
- 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
- 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
- 50 C → Y: in CDSP; loss of carnitine transport
- 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
- 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
- 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
- 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
- 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
- 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
- 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
- 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
- 508 F → L: in dbSNP:rs11568521
- 530 M → V: in dbSNP:rs11568524
- 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
26% identity, 79% coverage: 48:399/445 of query aligns to 119:475/563 of Q4U2R8
- Y230 (≠ F156) mutation to A: Loss of membrane protein expression and little uptake of cidofovir.
- K431 (≠ A354) mutation to A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- F438 (≠ Q362) mutation to A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 92 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 104 P → L: in dbSNP:rs11568627
- 113 modified: carbohydrate, N-linked (GlcNAc...) asparagine
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
30% identity, 37% coverage: 55:218/445 of query aligns to 39:203/446 of A0A0H2VG78
- R102 (= R118) mutation to A: Loss of transport activity.
- I105 (≠ T121) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E138) mutation to A: Loss of transport activity.
- Q137 (≠ S146) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 29% coverage: 47:176/445 of query aligns to 191:320/742 of Q02563
- DMCLS 196:200 (≠ EWGLS 52:56) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
Sites not aligning to the query:
- 321:331 mutation Missing: No change in uptake of BoNT/D or BoNT/E.
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
21% identity, 66% coverage: 21:315/445 of query aligns to 3:282/409 of 6e9nA
Sites not aligning to the query:
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
24% identity, 80% coverage: 46:399/445 of query aligns to 129:487/562 of O57379
- K394 (≠ T304) mutation to A: Reduced transport activity.
- R478 (= R390) mutation to D: Reduced transport activity.
Sites not aligning to the query:
- 34 H→I: Reduced transport activity.
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
24% identity, 78% coverage: 55:399/445 of query aligns to 144:482/550 of Q9NSA0
- G241 (= G159) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H305 (≠ T225) mutation to A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- G400 (≠ N318) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H469 (≠ L386) mutation to A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
24% identity, 41% coverage: 21:203/445 of query aligns to 6:187/393 of 6e9oA
Sites not aligning to the query:
O75751 Solute carrier family 22 member 3; Extraneuronal monoamine transporter; EMT; Organic cation transporter 3; OCT3 from Homo sapiens (Human) (see paper)
27% identity, 78% coverage: 69:413/445 of query aligns to 163:501/556 of O75751
- P289 (= P199) mutation to A: Decreased TEA uptake.
- V363 (≠ L269) mutation to F: Decreased TEA uptake.
- Y380 (≠ S288) mutation to F: Decreased TEA uptake.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
28% identity, 43% coverage: 51:242/445 of query aligns to 144:329/554 of O15245
- L160 (≠ V69) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ L101) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ T132) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ M152) mutation to F: Decreased TEA uptake.
- P283 (= P199) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (= R203) to G: in dbSNP:rs4646278
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 40% coverage: 65:242/445 of query aligns to 154:330/556 of Q63089
- C155 (≠ A66) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- C179 (≠ V90) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ V123) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ A124) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L125) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G126) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (≠ A127) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ A128) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ L129) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ P130) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ N131) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ T132) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ T133) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T134) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (= L135) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ L136) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ S137) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E138) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ Y139) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ L140) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
- S286 (= S201) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- S292 (vs. gap) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- T296 (≠ N209) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- C322 (≠ I234) mutation to S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- S328 (≠ Q240) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
Query Sequence
>Pf1N1B4_4198 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4198
MTSETVDIKAWIDNRKVAPYQWLIMGLCFFIVLFDGFDVAVMGFIAPSLIQEWGLSKAVF
GPVMSAGMVGLAIGALTAGPYADRLGRKKVLLTAVTGFSVLSLACAFARNPYELAALRLL
TGVALGAALPNTTTLLSEYLPERNRSLFITIMFTGFNMGSGLGGFLAAWLIPHHGWQSVL
LAGGILPLLLLPLMWLLLPESARFLAARNAPASQIAKVLNKLGGTFSAATKFVIAEPEAQ
QKAPLRLLFTEHYRFGTLALWATYFMGLLVIYLTMGWMPTLLREGGLSIERAATITGLFQ
IGGTVGAIVVGWAMDRRNPNAVIATSYALGGAFILLLGAFSLESSLLAFGVVAAGFCMSG
AQTGLNAFAPGYYPTDCRATGVSWMLGIGRFGAIFGSLIGGAVLSLGLGLPLLFALLSVP
AFIAALAIMANGHARRRVSRALLAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory