SitesBLAST
Comparing Pf1N1B4_4280 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
62% identity, 98% coverage: 7:340/341 of query aligns to 2:336/337 of 3nt5A
- active site: K97 (= K102), H176 (= H181)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K102), H155 (= H160), H176 (= H181), Y235 (= Y240)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), A12 (= A17), I13 (= I18), D35 (= D40), V36 (≠ I41), S74 (= S79), W75 (= W80), G76 (= G81), E96 (= E101), K97 (= K102), Y280 (= Y285)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
62% identity, 98% coverage: 7:340/341 of query aligns to 2:336/337 of 3nt4A
- active site: K97 (= K102), H176 (= H181)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (= H160), H176 (= H181), Y235 (= Y240), W272 (= W277)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), A12 (= A17), I13 (= I18), D35 (= D40), V36 (≠ I41), S74 (= S79), W75 (= W80), G76 (= G81), E96 (= E101), K97 (= K102), H176 (= H181)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
62% identity, 98% coverage: 7:340/341 of query aligns to 2:336/337 of 3nt2B
- active site: K97 (= K102), H176 (= H181)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G14), G11 (= G16), A12 (= A17), D35 (= D40), V36 (≠ I41), S74 (= S79), W75 (= W80), A78 (≠ S83), K97 (= K102), W272 (= W277), Y280 (= Y285)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
62% identity, 98% coverage: 7:340/341 of query aligns to 2:336/337 of 3nt2A
- active site: K97 (= K102), H176 (= H181)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), A12 (= A17), I13 (= I18), D35 (= D40), V36 (≠ I41), S74 (= S79), W75 (= W80), G76 (= G81), A78 (≠ S83), H79 (= H84), E96 (= E101), K97 (= K102), H176 (= H181), Y280 (= Y285)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
61% identity, 98% coverage: 7:340/341 of query aligns to 2:336/337 of 4l8vA
- active site: K97 (= K102), H176 (= H181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ A17), I13 (= I18), S74 (= S79), W75 (= W80), H79 (= H84), E96 (= E101), K97 (= K102), M126 (= M131), W272 (= W277), Y280 (= Y285)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
50% identity, 98% coverage: 7:340/341 of query aligns to 2:335/336 of 3ec7A
- active site: K97 (= K102), H176 (= H181)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M12 (≠ A17), I13 (= I18), D35 (= D40), I36 (= I41), R40 (≠ Q45), T73 (= T78), A74 (≠ S79), S75 (≠ W80), N76 (≠ G81), H79 (= H84), E96 (= E101), K97 (= K102), M126 (= M131), W271 (= W277), Y279 (= Y285)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
47% identity, 98% coverage: 8:340/341 of query aligns to 3:338/339 of 4mjlD
- active site: K97 (= K102)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K102), H155 (= H160), N157 (= N162), D172 (= D177), T173 (= T178), H176 (= H181), Y236 (= Y240)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), A12 (= A17), M13 (≠ I18), D35 (= D40), I36 (= I41), V73 (≠ T78), S74 (= S79), H79 (= H84), E96 (= E101), K97 (= K102), M126 (= M131), D172 (= D177), W274 (= W277), Y282 (= Y285)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
47% identity, 98% coverage: 8:340/341 of query aligns to 3:338/339 of 4mioD
- active site: K97 (= K102)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K102), H155 (= H160), N157 (= N162), D172 (= D177), T173 (= T178), H176 (= H181), Y236 (= Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (= A17), M13 (≠ I18), D35 (= D40), I36 (= I41), S74 (= S79), A78 (≠ S83), H79 (= H84), E96 (= E101), K97 (= K102), M126 (= M131), D172 (= D177), W274 (= W277), Y282 (= Y285)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
47% identity, 98% coverage: 8:340/341 of query aligns to 3:338/339 of 4mioA
- active site: K97 (= K102)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), A12 (= A17), M13 (≠ I18), D35 (= D40), I36 (= I41), S74 (= S79), F75 (≠ W80), H79 (= H84), E96 (= E101), K97 (= K102), W274 (= W277), Y282 (= Y285)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
47% identity, 98% coverage: 8:340/341 of query aligns to 3:338/339 of 4minA
- active site: K97 (= K102)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), A12 (= A17), M13 (≠ I18), D35 (= D40), I36 (= I41), V73 (≠ T78), S74 (= S79), F75 (≠ W80), H79 (= H84), E96 (= E101), K97 (= K102), Y282 (= Y285)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
26% identity, 95% coverage: 7:331/341 of query aligns to 2:338/340 of 4n54A
- active site: K96 (= K102), H183 (= H181)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ A17), K96 (= K102), D156 (≠ N162), D179 (= D177), M180 (≠ T178), H183 (= H181), R238 (≠ K224), Y244 (= Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I13), G9 (= G14), L10 (≠ T15), G11 (= G16), R12 (≠ A17), L13 (≠ I18), S35 (≠ D40), V36 (≠ I41), E40 (≠ N42), S73 (= S79), P74 (≠ W80), F77 (≠ S83), H78 (= H84), E95 (= E101), K96 (= K102), M125 (= M131), F167 (≠ M173), F284 (≠ W277)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
25% identity, 96% coverage: 8:333/341 of query aligns to 5:342/342 of 3ceaA
- active site: K98 (= K102), H185 (= H181)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), G13 (= G16), R14 (≠ A17), L15 (≠ I18), L38 (≠ I41), Q42 (= Q45), V74 (≠ T78), A75 (≠ S79), P76 (≠ W80), T77 (≠ G81), F79 (≠ S83), H80 (= H84), M83 (≠ F87), E97 (= E101), K98 (= K102), M127 (= M131), F169 (≠ M173), H185 (= H181), F286 (≠ W277)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
27% identity, 72% coverage: 8:251/341 of query aligns to 2:247/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G16), F11 (≠ A17), M12 (≠ I18), D33 (= D40), L34 (≠ I41), T70 (= T78), T71 (≠ S79), P72 (≠ W80), N73 (≠ G81), L75 (≠ S83), H76 (= H84), Q79 (≠ F87), E93 (= E101), K94 (= K102), N122 (≠ F130), W161 (≠ E167), H179 (= H181)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
27% identity, 72% coverage: 8:251/341 of query aligns to 2:247/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ A17), F152 (≠ H160), N154 (= N162), D175 (= D177), L176 (≠ T178), H179 (= H181), E236 (≠ Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G16), F11 (≠ A17), M12 (≠ I18), D33 (= D40), L34 (≠ I41), T70 (= T78), T71 (≠ S79), P72 (≠ W80), N73 (≠ G81), L75 (≠ S83), H76 (= H84), Q79 (≠ F87), E93 (= E101), K94 (= K102), N122 (≠ F130), W161 (≠ E167), H179 (= H181)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
27% identity, 72% coverage: 8:251/341 of query aligns to 2:247/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ A17), N154 (= N162), D175 (= D177), H179 (= H181), E236 (≠ Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G14), G10 (= G16), F11 (≠ A17), M12 (≠ I18), D33 (= D40), L34 (≠ I41), T70 (= T78), T71 (≠ S79), P72 (≠ W80), N73 (≠ G81), L75 (≠ S83), H76 (= H84), Q79 (≠ F87), E93 (= E101), K94 (= K102), N122 (≠ F130), W161 (≠ E167)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
7xr9A Crystal structure of dgpa with glucose (see paper)
31% identity, 48% coverage: 40:201/341 of query aligns to 29:200/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K102), R150 (≠ H160), W157 (≠ V165), F160 (vs. gap), D173 (= D177), H177 (= H181)
- binding nicotinamide-adenine-dinucleotide: D51 (= D62), Y52 (≠ G63), C67 (≠ T78), T68 (≠ S79), P69 (≠ W80), H73 (= H84), E90 (= E101), K91 (= K102), P92 (= P103), Q119 (≠ M131), V159 (vs. gap), F160 (vs. gap), Q166 (≠ K170)
Sites not aligning to the query:
7xreC Crystal structure of dgpa (see paper)
30% identity, 47% coverage: 33:192/341 of query aligns to 31:198/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (= D40), I39 (= I41), T78 (≠ S79), P79 (≠ W80), N80 (≠ G81), H83 (= H84), E100 (= E101), K101 (= K102), P102 (= P103), F170 (vs. gap), Q176 (≠ K170), H187 (= H181)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
29% identity, 54% coverage: 9:193/341 of query aligns to 3:192/333 of Q2I8V6
- ASTI 9:12 (≠ TGAI 15:18) binding NADP(+)
- S10 (≠ G16) mutation to G: Almost no effect.
- A13 (≠ G19) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ D40) mutation to D: No activity.
- ST 33:34 (≠ DI 40:41) binding NADP(+)
- R38 (≠ Q45) binding NADP(+)
- TTNELH 71:76 (≠ SWGPSH 79:84) binding NADP(+)
- EK 93:94 (= EK 101:102) binding NADP(+)
- K94 (= K102) mutation to G: Less than 1% remaining activity.
- N120 (≠ V128) binding NADP(+)
- WR 162:163 (≠ YK 169:170) binding NADP(+)
- D176 (= D177) mutation to A: Less than 1% remaining activity.
- H180 (= H181) mutation to A: Less than 2% remaining activity.
Sites not aligning to the query:
- 206 G→I: No effect.
- 283 binding NADP(+)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
29% identity, 54% coverage: 9:193/341 of query aligns to 2:191/332 of 2glxA
- active site: K93 (= K102), H179 (= H181)
- binding acetate ion: K93 (= K102), H179 (= H181)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G14), A8 (≠ T15), S9 (≠ G16), T10 (≠ A17), I11 (= I18), S32 (≠ D40), T33 (≠ I41), R37 (≠ Q45), S69 (≠ T78), T70 (≠ S79), N72 (≠ G81), H75 (= H84), E92 (= E101), K93 (= K102), H121 (≠ F130), W161 (≠ Y169), R162 (≠ K170)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
26% identity, 75% coverage: 12:266/341 of query aligns to 8:277/348 of 3e18A
- active site: K94 (= K102), H178 (= H181)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G13 (≠ A17), M14 (≠ I18), F34 (≠ T39), D35 (= D40), I36 (= I41), K40 (= K48), A70 (≠ T78), T71 (≠ S79), P72 (≠ W80), N73 (≠ G81), H76 (= H84), E93 (= E101), K94 (= K102), N122 (vs. gap), W161 (≠ G166), R162 (≠ E167), H178 (= H181)
Query Sequence
>Pf1N1B4_4280 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4280
MSLLSNSLRIGVIGTGAIGQDHIRRCSQTLLNSQVVAVTDINLQQAAKVVSDLKLTAEVY
PDGHALIKAPEVDAILVTSWGPSHEEFVLAAIAAGKPVFCEKPLAVTAEGCRKIVEAEVA
HGKRLVQVGFMRPYDEGYRALKAVIDSGQIGEPLMLHCAHRNPTVGENYKTDMAITDTLI
HELDVLRWLLDDDYVSVQVVFPRKTSKAHAHLKDPQIVLLETAKGTRIDVEVFVNCQYGY
DIQCEVVGETGIAKLPEPSQVQLRSGAKLSNAILMDWKDRFIAAYDVELQAFIDGVRAGQ
VGGPSAWDGFAAAVAADACIEAQSSGQIVKVGLPDRPHFYG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory