SitesBLAST
Comparing Pf1N1B4_4413 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4413 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
32% identity, 88% coverage: 11:405/451 of query aligns to 15:420/425 of O59010
- S65 (≠ T55) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S266) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 266:268) binding
- M311 (≠ P301) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ Q304) binding
- V355 (= V345) binding
- D394 (≠ S379) binding
- M395 (≠ E380) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R382) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N386) binding
- D405 (≠ N390) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
32% identity, 86% coverage: 11:399/451 of query aligns to 6:405/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
32% identity, 87% coverage: 11:404/451 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L36), F46 (≠ L36), P75 (≠ N65), L91 (≠ V82), F95 (≠ L86), L130 (≠ F128), I133 (≠ F131), I159 (= I157), Y167 (≠ H165), K196 (≠ R186), G200 (≠ M190), I207 (= I197), F210 (= F200), L250 (≠ I240), I262 (≠ L252), M269 (≠ L259), T334 (= T324), V335 (≠ L325), G336 (≠ T326), T340 (≠ I330), L343 (≠ A333), M399 (≠ I384)
- binding aspartic acid: S277 (= S267), S278 (= S268), T314 (≠ Q304), G354 (= G344), A358 (≠ S348), G359 (= G349), D394 (≠ S379), R397 (= R382), T398 (≠ A383)
- binding sodium ion: Y89 (≠ F80), T92 (≠ V83), S93 (= S84), G306 (= G296), T308 (= T298), N310 (= N300), N310 (= N300), M311 (≠ P301), D312 (= D302), S349 (= S339), I350 (≠ K340), T352 (≠ S342), N401 (= N386), V402 (≠ T387), D405 (≠ N390)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
32% identity, 86% coverage: 11:399/451 of query aligns to 12:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G59), V83 (≠ L77), I157 (≠ L158), Y164 (≠ H165), K193 (≠ R186), T305 (= T298), I306 (≠ F299), I347 (≠ K340)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V12), M199 (= M192), S275 (= S268), T311 (≠ Q304), G356 (= G349), L384 (= L372), D391 (≠ S379), R394 (= R382)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
32% identity, 87% coverage: 11:402/451 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
32% identity, 86% coverage: 11:399/451 of query aligns to 7:406/408 of 6bauA
- binding cysteine: S270 (= S268), M303 (≠ P301), T306 (≠ Q304), A345 (= A343), G346 (= G344), V347 (= V345), G351 (= G349), D386 (≠ S379), C389 (≠ R382), T390 (≠ A383), N393 (= N386)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 88% coverage: 11:408/451 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S266), S265 (= S268), M299 (≠ P301), T302 (≠ Q304), T340 (≠ S342), G342 (= G344), V343 (= V345), G347 (= G349), D383 (≠ S379), R386 (= R382), T387 (≠ A383), N390 (= N386)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E28), V212 (≠ L215), A216 (≠ G219)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 88% coverage: 11:408/451 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R186), G195 (≠ M190), R282 (≠ I276)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S266), S272 (= S267), S273 (= S268), M307 (≠ P301), T310 (≠ Q304), G353 (= G347), A354 (≠ S348), R394 (= R382), T395 (≠ A383)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 88% coverage: 11:408/451 of query aligns to 11:421/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 88% coverage: 11:408/451 of query aligns to 13:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 88% coverage: 11:408/451 of query aligns to 13:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S266), S275 (= S267), S276 (= S268), T313 (≠ Q304), G353 (= G344), V354 (= V345), A357 (≠ S348), G358 (= G349), D394 (≠ S379), R397 (= R382), T398 (≠ A383)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R186), G198 (≠ M190), Y202 (≠ L194)
- binding sodium ion: Y87 (≠ F80), T90 (≠ V83), S91 (= S84), S276 (= S268), G305 (= G296), A306 (≠ L297), T307 (= T298), N309 (= N300), N309 (= N300), M310 (≠ P301), D311 (= D302), S348 (= S339), I349 (≠ K340), G350 (= G341), T351 (≠ S342), N401 (= N386), V402 (≠ T387), D405 (≠ N390)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
31% identity, 86% coverage: 11:399/451 of query aligns to 7:394/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 79% coverage: 37:393/451 of query aligns to 57:394/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L69), G89 (= G70), G92 (= G73), A95 (= A76), V96 (≠ L77), Y99 (≠ F80), M163 (≠ I157), F167 (≠ V161), F293 (≠ M291), V297 (≠ S295)
- binding aspartic acid: S268 (= S267), S269 (= S268), T306 (≠ Q304), G346 (= G344), I347 (≠ V345), A350 (≠ S348), G351 (= G349), D380 (≠ S379), R383 (= R382), T384 (≠ A383)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 79% coverage: 37:393/451 of query aligns to 49:380/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I60), S80 (≠ L69), G81 (= G70), G84 (= G73), Y91 (≠ F80), M156 (≠ I157), F160 (≠ V161), F286 (≠ M291), V290 (≠ S295)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I52), I148 (≠ V149), S262 (= S268), S263 (≠ E269), A292 (≠ L297), T293 (= T298), M296 (≠ P301), T299 (≠ Q304), G329 (= G341), A336 (≠ S348), G337 (= G349), D366 (≠ S379), R369 (= R382), N373 (= N386)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 84% coverage: 16:393/451 of query aligns to 19:406/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S267), S281 (= S268), T318 (≠ Q304), G363 (= G349), M367 (≠ L353), V385 (≠ L372), D388 (= D375), R395 (= R382), T396 (≠ A383)
- binding dodecyl beta-D-glucopyranoside: V19 (= V16), I20 (= I17), W389 (≠ R376)
- binding cholesterol hemisuccinate: R80 (= R71), R84 (= R75), I95 (≠ L86), I252 (≠ A230)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 84% coverage: 16:393/451 of query aligns to 18:407/425 of 7xr4A
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
28% identity, 85% coverage: 15:399/451 of query aligns to 11:400/406 of 8ctcA
- binding glutamic acid: S268 (= S267), S269 (= S268), M303 (≠ P301), T306 (≠ Q304), G346 (= G344), A350 (≠ S348), D380 (≠ S379), R383 (= R382)
- binding sodium ion: Y82 (≠ F80), T85 (≠ V83), T86 (≠ S84), S269 (= S268), G298 (= G296), A299 (≠ L297), T300 (= T298), N302 (= N300), N302 (= N300), M303 (≠ P301), D304 (= D302), S341 (= S339), I342 (≠ K340), G343 (= G341), A344 (≠ S342), N387 (= N386), D391 (≠ N390)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
28% identity, 85% coverage: 15:399/451 of query aligns to 14:403/416 of 8cuaA
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
27% identity, 85% coverage: 15:399/451 of query aligns to 14:421/433 of 8cv2A
- binding sodium ion: Y85 (≠ F80), T88 (≠ V83), T89 (≠ S84), G319 (= G296), A320 (≠ L297), N323 (= N300), N323 (= N300), M324 (≠ P301), D325 (= D302), N408 (= N386), D412 (≠ N390)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 84% coverage: 16:393/451 of query aligns to 11:391/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T55), L58 (≠ V56), L65 (≠ M63), V339 (≠ K340), G340 (= G341), S343 (≠ G344), I344 (≠ V345)
- binding cholesterol: W188 (≠ R193), I227 (≠ K220), F250 (≠ Y243), W257 (= W249), M379 (≠ A381), S382 (≠ I384)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S268), M300 (≠ P301), T303 (≠ Q304), Y306 (= Y307), G348 (= G349), L349 (≠ F350), M352 (≠ L353), I366 (≠ M368), L369 (= L371), V370 (≠ L372), D373 (= D375), D377 (≠ S379), R380 (= R382), T381 (≠ A383), N384 (= N386)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4413 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4413
MKRIFGKLYVQVLIAVILGAIVGVFVPETGTALKPLGDAFIKLIKMLLAPVIFLTVVTGI
ARMENMKELGRVGFRALIYFEVVSTLALVVGLVVVDVFKPGAGMNIDVASLDTSSLATYT
TAVKHASFMDFVMNIIPDTIVDAFAKGNVLQILLFSILLGVALAHVGPRAKVFVDTLDSL
MQGMFRIVNMVMRLAPIGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPI
CRYSGFSLWKFLKFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFN
PDGQAIYYTIAAIFIAQATNTPLTLTDQLIVLAVLMFTSKGSAGVTGSGFIILAATLSSL
GTIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDTVKMHKALNGEAAEQ
KPETVQADIVAVPSAMPAKSLLPDFKSVSQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory