SitesBLAST
Comparing Pf1N1B4_4511 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4511 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
52% identity, 95% coverage: 7:263/270 of query aligns to 1:257/265 of Q7CRQ0
- Y134 (= Y141) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
52% identity, 95% coverage: 7:263/270 of query aligns to 2:258/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S80), S110 (= S116), N111 (= N117), H112 (= H118), Y135 (= Y141), S164 (= S170), R173 (= R179), F257 (= F262)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G14), G12 (= G17), Q13 (≠ G18), L14 (= L19), D33 (= D38), L34 (≠ I39), D50 (= D56), L51 (= L57), L70 (≠ F76), G71 (= G77), G72 (= G78), S74 (= S80), A108 (= A114), S110 (= S116), Y135 (= Y141), K139 (= K145), I162 (= I168), S164 (= S170), C165 (≠ S171)
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
51% identity, 95% coverage: 7:263/270 of query aligns to 2:258/265 of 3rfxA
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
32% identity, 59% coverage: 10:167/270 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S116), Y132 (= Y141), K136 (= K145)
- binding nicotinamide-adenine-dinucleotide: G9 (= G17), R10 (≠ G18), V11 (≠ L19), D30 (= D38), L31 (≠ M42), R32 (≠ A43), S44 (≠ D56), L45 (= L57), L64 (≠ F76), A66 (≠ G78), V81 (≠ A91), S106 (= S116), Y132 (= Y141), K136 (= K145)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
32% identity, 59% coverage: 10:167/270 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S116), Y133 (= Y141), K137 (= K145)
- binding nicotinamide-adenine-dinucleotide: G10 (= G17), R11 (≠ G18), V12 (≠ L19), D31 (= D38), L32 (≠ M42), S45 (≠ D56), L46 (= L57), L65 (≠ F76), A67 (≠ G78), V82 (≠ A91), Y133 (= Y141), K137 (= K145)
Sites not aligning to the query:
6jygD Crystal structure of l-threonine dehydrogenase from phytophthora infestans (see paper)
30% identity, 59% coverage: 8:167/270 of query aligns to 1:162/307 of 6jygD
- binding citrate anion: Q11 (≠ G18), L73 (≠ S80), S74 (≠ V81), Y136 (= Y141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), T9 (≠ A16), G10 (= G17), Q11 (≠ G18), I12 (≠ L19), D33 (= D38), I34 (= I39), K35 (≠ A40), D47 (= D56), V48 (≠ L57), M69 (≠ F76), A70 (≠ G77), S71 (≠ G78), L73 (≠ S80), V87 (≠ A91), P109 (≠ A114), S110 (= S115), T111 (≠ S116), Y136 (= Y141), K140 (= K145)
Sites not aligning to the query:
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
29% identity, 61% coverage: 9:172/270 of query aligns to 3:181/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), F12 (≠ G18), I13 (≠ L19), D32 (≠ S37), N33 (≠ D38), N35 (vs. gap), Y38 (vs. gap), K43 (≠ A43), D61 (= D56), L62 (= L57), L83 (≠ F76), A84 (≠ G77), A85 (vs. gap), A123 (= A114), Y150 (= Y141), K154 (= K145), F177 (≠ I168), V180 (≠ S171)
Sites not aligning to the query:
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 59% coverage: 10:167/270 of query aligns to 2:163/311 of 3a4vA
- active site: T112 (≠ S116), Y137 (= Y141), K141 (= K145)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A16), G9 (= G17), Q10 (≠ G18), I11 (≠ L19), D32 (≠ A45), I33 (= I46), L46 (≠ C55), D47 (= D56), V48 (≠ L57), L69 (≠ F76), A70 (≠ G77), G71 (= G78), L73 (vs. gap), P110 (≠ A114), S111 (= S115), T112 (≠ S116), Y137 (= Y141), K141 (= K145)
- binding pyruvic acid: S74 (vs. gap), Y137 (= Y141)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 59% coverage: 10:167/270 of query aligns to 2:163/315 of 3a1nA
- active site: T112 (≠ S116), Y137 (= Y141), K141 (= K145)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A16), G9 (= G17), Q10 (≠ G18), I11 (≠ L19), D32 (≠ A45), I33 (= I46), L46 (≠ C55), D47 (= D56), L69 (≠ F76), A70 (≠ G77), G71 (= G78), L73 (vs. gap), S111 (= S115), Y137 (= Y141), K141 (= K145)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
29% identity, 59% coverage: 9:167/270 of query aligns to 2:157/304 of 3aw9A
- active site: A105 (= A114), S107 (= S116), S108 (≠ N117), T109 (≠ H118), Y131 (= Y141), K135 (= K145)
- binding galactose-uridine-5'-diphosphate: P69 (≠ S80), V71 (≠ E82), S107 (= S116), Y131 (= Y141)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (≠ G18), I12 (≠ L19), D31 (= D38), I32 (= I39), R46 (≠ C55), D47 (= D56), L48 (= L57), F65 (= F76), A66 (≠ G77), A67 (≠ G78), E82 (≠ A91), A105 (= A114), S106 (= S115), Y131 (= Y141), K135 (= K145)
Sites not aligning to the query:
- active site: 166, 169
- binding galactose-uridine-5'-diphosphate: 160, 168, 170, 173, 188, 193, 195, 197, 234, 263, 266
- binding nicotinamide-adenine-dinucleotide: 158, 160, 161, 168
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
28% identity, 59% coverage: 8:167/270 of query aligns to 1:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), Q11 (≠ G18), I12 (≠ L19), D33 (= D38), I34 (= I39), R35 (≠ M42), L48 (≠ C55), D49 (= D56), V50 (≠ L57), A72 (≠ G77), A73 (≠ G78), L75 (vs. gap), P112 (≠ A114), S114 (= S116), Y139 (= Y141), K143 (= K145)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 59% coverage: 10:167/270 of query aligns to 2:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A16), G9 (= G17), Q10 (≠ G18), I11 (≠ L19), D32 (≠ A45), I33 (= I46), L46 (≠ C55), D47 (= D56), V48 (≠ L57), L69 (≠ F76), A70 (≠ G77), G71 (= G78), L73 (vs. gap), P110 (≠ A114), S111 (= S115), T112 (≠ S116), F137 (≠ Y141), K141 (= K145)
- binding (3R)-3-hydroxy-L-norvaline: S74 (vs. gap), T112 (≠ S116), I113 (≠ N117), F137 (≠ Y141)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 59% coverage: 10:167/270 of query aligns to 2:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A16), G9 (= G17), Q10 (≠ G18), I11 (≠ L19), D32 (≠ A45), I33 (= I46), L46 (≠ C55), D47 (= D56), V48 (≠ L57), L69 (≠ F76), A70 (≠ G77), L73 (vs. gap), V87 (≠ A91), P110 (≠ A114), S111 (= S115), K141 (= K145)
- binding threonine: S74 (vs. gap), T112 (≠ S116), F137 (≠ Y141)
Sites not aligning to the query:
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
28% identity, 61% coverage: 9:172/270 of query aligns to 3:176/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), F12 (≠ G18), I13 (≠ L19), D32 (≠ S37), N33 (≠ D38), N35 (vs. gap), Y38 (vs. gap), K43 (≠ A43), D61 (= D56), L62 (= L57), L83 (≠ F76), A84 (≠ G77), A85 (≠ G78), A118 (= A114), Y145 (= Y141), K149 (= K145), F172 (≠ I168), F173 (≠ G169), T174 (≠ S170), V175 (≠ S171)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
28% identity, 63% coverage: 9:177/270 of query aligns to 3:180/308 of 6wj9B
- active site: A119 (≠ S116), A120 (≠ N117), A121 (≠ H118), F144 (≠ Y141), K148 (= K145)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), F12 (≠ G18), I13 (≠ L19), D32 (= D38), D33 (vs. gap), S35 (vs. gap), T36 (vs. gap), G37 (vs. gap), D55 (= D56), A56 (≠ L57), L75 (≠ F76), A76 (≠ G77), A77 (≠ G78), S94 (≠ A91), A117 (= A114), A119 (≠ S116), F144 (≠ Y141), K148 (= K145), F171 (≠ I168), F172 (≠ G169), I174 (≠ S171)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V81), N173 (≠ S170)
Sites not aligning to the query:
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
27% identity, 59% coverage: 9:167/270 of query aligns to 4:166/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), C11 (≠ A16), G12 (= G17), Q13 (≠ G18), I14 (≠ L19), D35 (= D38), I36 (= I39), L49 (≠ C55), V51 (≠ L57), L72 (≠ F76), A73 (≠ G77), L76 (≠ S80), P113 (≠ A114), S115 (= S116), Y140 (= Y141), K144 (= K145)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
28% identity, 63% coverage: 9:177/270 of query aligns to 2:179/307 of 6wjaA
- active site: A118 (≠ S116), A119 (≠ N117), A120 (≠ H118), F143 (≠ Y141), K147 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (≠ G18), I12 (≠ L19), D31 (= D38), D32 (vs. gap), S34 (vs. gap), T35 (vs. gap), G36 (vs. gap), A55 (≠ L57), L74 (≠ F76), A75 (≠ G77), A76 (≠ G78), S93 (≠ A91), F143 (≠ Y141), K147 (= K145), F170 (≠ I168), F171 (≠ G169), I173 (≠ S171)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V81), A120 (≠ H118), N172 (≠ S170)
Sites not aligning to the query:
2c59A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site. (see paper)
28% identity, 60% coverage: 9:169/270 of query aligns to 18:188/364 of 2c59A
- active site: S132 (= S116), A133 (≠ N117), C134 (≠ H118), Y163 (= Y141), K167 (= K145)
- binding guanosine-5'-diphosphate-beta-l-galactose: M91 (vs. gap), G92 (= G77), G93 (= G78), M94 (≠ V79), S132 (= S116), C134 (≠ H118)
- binding guanosine-5'-diphosphate-alpha-d-mannose: G92 (= G77), M94 (≠ V79), I97 (≠ V81), S132 (= S116), C134 (≠ H118), Y163 (= Y141)
- binding nicotinamide-adenine-dinucleotide: G23 (= G14), G26 (= G17), F27 (≠ G18), I28 (≠ L19), D47 (= D38), W48 (≠ I39), K49 (≠ A40), D67 (= D56), L68 (= L57), L87 (≠ F76), A89 (vs. gap), M91 (vs. gap), I111 (≠ G95), A130 (= A114), S132 (= S116), Y163 (= Y141), K167 (= K145)
Sites not aligning to the query:
- active site: 206
- binding guanosine-5'-diphosphate-beta-l-galactose: 191, 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 345
- binding guanosine-5'-diphosphate-alpha-d-mannose: 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 295, 345
- binding nicotinamide-adenine-dinucleotide: 190, 192, 193, 206
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 60% coverage: 9:169/270 of query aligns to 29:199/377 of Q93VR3
- 34:60 (vs. 14:40, 26% identical) binding
- D58 (= D38) binding
- D78 (= D56) binding
- C145 (≠ H118) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y141) binding ; mutation to F: Loss of activity.
- K178 (= K145) binding ; mutation to R: Strong reduction of activity.
Sites not aligning to the query:
- 217 K→A: Loss of activity.
- 306 R→A: Strong reduction of activity.
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
30% identity, 63% coverage: 9:177/270 of query aligns to 2:187/322 of 1r66A
- active site: T127 (≠ S116), D128 (≠ N117), E129 (≠ H118), Y151 (= Y141), K155 (= K145)
- binding nicotinamide-adenine-dinucleotide: G10 (= G17), F11 (≠ G18), I12 (≠ L19), D37 (≠ S37), S38 (≠ D38), L39 (≠ I39), T40 (vs. gap), G43 (vs. gap), D63 (= D56), I64 (≠ L57), F83 (= F76), A84 (≠ G77), A85 (≠ G78), S87 (= S80), T102 (vs. gap), V125 (≠ A114), S126 (= S115), Y151 (= Y141), K155 (= K145), N181 (≠ S171)
- binding thymidine-5'-diphosphate: H88 (vs. gap), E129 (≠ H118), N180 (≠ S170)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4511 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4511
MTNTSPFNRLLLTGAAGGLGKVLRERLRPYANVLRLSDIANMAPAIDDREEVVPCDLADK
QAVHQLVEGVDAILHFGGVSVERPFEEILGANICGVFHIYEAARRHGVKRVIFASSNHVI
GFYKQDKTLDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFPEPQNRRM
MSTWLSFDDMTQLLERALYTPNVGHTVVYGMSANKSVWWDNRFAAHLGFAPQDTSEVFRE
KVEAQPMPAEDDPARVYQGGAFVAAGPFGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory