Comparing Pf1N1B4_4963 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4963 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
27% identity, 87% coverage: 31:308/321 of query aligns to 7:285/300 of 2dvzA
7ndrD Crystal structure of tphc in an open conformation (see paper)
24% identity, 89% coverage: 31:315/321 of query aligns to 5:288/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
24% identity, 89% coverage: 31:315/321 of query aligns to 5:288/294 of 7ndsA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
22% identity, 90% coverage: 31:320/321 of query aligns to 5:297/302 of 8hkbA
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
26% identity, 87% coverage: 40:318/321 of query aligns to 15:281/296 of 6hkeB
Sites not aligning to the query:
2f5xB Structure of periplasmic binding protein bugd (see paper)
23% identity, 80% coverage: 31:286/321 of query aligns to 7:261/300 of 2f5xB
>Pf1N1B4_4963 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4963
MFALARRFSSNLAVLVTAAALASPVFALDTVKFMAPGSVGGGYDQTARVLGKAMVEAKTA
KSTTFENKGGAGGTLGLAQFANGTKGDANALIVVGAIMVAAIEQNKPQITLKDVTPIARL
FTEYNVIAVRDDSPYKTLGDLLKDFKANPSSIKWGGGSKGSIDHIGIAELASKMDVPVNK
VNYVAFAGGGEVVAAVLGGHITVITGGYAELAKYVQSKQFRLLAIGAPNRVEGIDAPTLK
EAGYDVTIGNWRGVYGAAGLTPEQRKELTEAVLTATKSNVWQENVKTNAWSPSILTGDDF
GKFVEEEHGRLRAMLVKVGLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory