SitesBLAST
Comparing Pf1N1B4_5112 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5112 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 13:402/404 of 6jahA
- binding (2S)-heptane-1,2,7-triol: Y309 (≠ A296), E310 (≠ Q297), K313 (= K300), R332 (≠ P319)
- binding propane-2,2-diol: D160 (≠ N147), W162 (= W149)
- binding alpha-D-glucopyranose: D68 (= D56), D116 (= D104), G173 (= G160), E228 (= E215), W246 (= W233), G283 (= G270), G284 (= G271), W285 (= W272), R354 (= R341)
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 13:402/404 of 6jagA
- binding beta-D-fructofuranose: R47 (= R35), F114 (= F102), D116 (= D104), E228 (= E215), W246 (= W233), W285 (= W272), R321 (≠ Y308)
- binding alpha-D-glucopyranose: D68 (= D56), D116 (= D104), G173 (= G160), E228 (= E215), W246 (= W233), G283 (= G270), G284 (= G271), W285 (= W272), R354 (= R341)
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 13:402/404 of 6jadA
- binding alpha-D-glucopyranose: D68 (= D56), D116 (= D104), G173 (= G160), E228 (= E215), W246 (= W233), G283 (= G270), G284 (= G271), W285 (= W272), R354 (= R341)
- binding alpha-D-fructofuranose: R47 (= R35), F114 (= F102), D116 (= D104), Y248 (= Y235), W285 (= W272)
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 13:402/404 of 6j9yA
- binding carbonate ion: E373 (≠ R360), K382 (≠ L369), D390 (≠ E377)
- binding alpha-D-glucopyranose: A42 (≠ N30), R47 (= R35), D68 (= D56), D116 (= D104), D116 (= D104), G173 (= G160), E228 (= E215), W246 (= W233), G283 (= G270), G284 (= G271), W285 (= W272), W285 (= W272), R321 (≠ Y308), R354 (= R341)
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 15:404/406 of 6jamA
- binding alpha-D-glucopyranose: T46 (≠ A32), R49 (= R35), D70 (= D56), F116 (= F102), D118 (= D104), D118 (= D104), G175 (= G160), E230 (= E215), W248 (= W233), Y250 (= Y235), G285 (= G270), G286 (= G271), W287 (= W272), W287 (= W272)
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 13:402/404 of 6jaiA
- binding calcium ion: P247 (= P234), Y248 (= Y235), R321 (≠ Y308)
- binding alpha-D-glucopyranose: V13 (= V1), T44 (≠ A32), D68 (= D56), G173 (= G160), E228 (= E215), W246 (= W233), G283 (= G270), G284 (= G271), W285 (= W272), W285 (= W272), R321 (≠ Y308), R354 (= R341)
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
45% identity, 100% coverage: 1:389/390 of query aligns to 13:402/404 of 6jb0A
- binding alpha-D-glucopyranose: T44 (≠ A32), R47 (= R35), D68 (= D56), F114 (= F102), D116 (= D104), D116 (= D104), G173 (= G160), E228 (= E215), W246 (= W233), W246 (= W233), Y248 (= Y235), G283 (= G270), G284 (= G271), R354 (= R341)
- binding 1,3-propandiol: E15 (≠ A3), R318 (≠ I305)
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
37% identity, 98% coverage: 1:382/390 of query aligns to 11:387/391 of 6dtqA
- binding alpha-D-glucopyranose: V11 (= V1), E14 (= E4), R46 (= R35), D67 (= D56), D115 (= D104), D115 (= D104), G166 (= G160), E222 (= E215), W240 (= W233), W240 (= W233), G277 (= G271), W278 (= W272), W278 (= W272), Q316 (≠ Y308), R349 (= R341)
- binding magnesium ion: T59 (≠ S48), D60 (= D49), D62 (= D51), E290 (≠ H282)
7qhvAAA Sulfoquinovosyl binding protein (see paper)
34% identity, 95% coverage: 16:387/390 of query aligns to 26:386/390 of 7qhvAAA
- binding [(2~{S},3~{S},4~{S},5~{R},6~{S})-6-[(2~{S})-3-butanoyloxy-2-heptanoyloxy-propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: N40 (= N30), T41 (≠ S31), S42 (≠ A32), D66 (= D56), F109 (= F102), D111 (= D104), E163 (= E159), G164 (= G160), A217 (≠ T214), T218 (≠ E215), D219 (≠ E216), W236 (= W233), G272 (= G270), G273 (= G271), W274 (= W272), R343 (= R341)
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
33% identity, 95% coverage: 16:387/390 of query aligns to 55:416/416 of A9CEY9
- S71 (≠ A32) binding
- D95 (= D56) binding
- D141 (= D104) binding
- G194 (= G160) binding
- T248 (≠ E215) binding
- G303 (= G271) binding ; binding
- W304 (= W272) binding ; binding
- R373 (= R341) binding ; binding
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
33% identity, 95% coverage: 16:387/390 of query aligns to 27:388/389 of 7ofyA
- binding [(2S,3S,4S,5R,6S)-6-[(2R)-2,3-bis(oxidanyl)propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T42 (≠ S31), S43 (≠ A32), D67 (= D56), D113 (= D104), G166 (= G160), T220 (≠ E215), W238 (= W233), Y240 (= Y235), G274 (= G270), G275 (= G271), W276 (= W272), R345 (= R341)
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
33% identity, 95% coverage: 16:385/390 of query aligns to 25:384/384 of 7yzsAAA
- binding 6-deoxy-6-sulfo-beta-D-glucopyranose: T40 (≠ S31), S41 (≠ A32), D65 (= D56), D111 (= D104), E163 (= E159), G164 (= G160), T218 (≠ E215), W236 (= W233), G272 (= G270), G273 (= G271), W274 (= W272), R343 (= R341)
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
33% identity, 99% coverage: 4:388/390 of query aligns to 16:407/407 of 1eu8A
- binding alpha-D-glucopyranose: E16 (= E4), T43 (≠ N30), T45 (≠ A32), R48 (= R35), D69 (= D56), Y120 (≠ F102), D122 (= D104), G178 (= G160), E238 (= E215), W256 (= W233), Y258 (= Y235), G292 (= G270), G293 (= G271), W294 (= W272), R363 (= R341)
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
33% identity, 95% coverage: 16:385/390 of query aligns to 24:381/382 of 7yzuA
- binding [(2S,3S,4S,5R,6S)-6-methoxy-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T39 (≠ S31), S40 (≠ A32), D64 (= D56), D110 (= D104), E162 (= E159), G163 (= G160), T215 (≠ E215), W233 (= W233), G269 (= G270), G270 (= G271), W271 (= W272), R340 (= R341)
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
33% identity, 99% coverage: 4:388/390 of query aligns to 57:448/450 of Q7LYW7
- E57 (= E4) binding
- T84 (≠ N30) binding
- R89 (= R35) binding
- D110 (= D56) binding
- Y161 (≠ F102) binding
- D163 (= D104) binding
- Y217 (= Y158) binding
- E279 (= E215) binding
- W297 (= W233) binding
- Y299 (= Y235) binding
- G334 (= G271) binding
- W335 (= W272) binding
- W371 (≠ Y308) binding
- R404 (= R341) binding
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
27% identity, 83% coverage: 23:344/390 of query aligns to 67:427/471 of G7CES0
- Q79 (≠ E34) binding ; mutation to A: About 10-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- D100 (= D56) binding ; mutation to A: Structurally unstable.
- N154 (≠ D104) binding ; mutation to A: About 100-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- Y198 (= Y158) binding
- E261 (= E215) mutation to A: Loss of trehalose-binding.
- W279 (= W233) binding ; mutation to A: Loss of trehalose-binding.
- Y281 (= Y235) binding
- G354 (= G271) binding
- L355 (≠ W272) mutation to A: About 13-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- C375 (≠ Y292) modified: Disulfide link with 57
- R424 (= R341) binding ; mutation to A: Loss of trehalose-binding.
Sites not aligning to the query:
- 45 binding ; N→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; N→T: Increased trehalose-binding; when associated with D-46.
- 46 binding ; E→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; E→D: Increased trehalose-binding; when associated with T-45.
- 57 modified: Disulfide link with 375
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
27% identity, 83% coverage: 23:344/390 of query aligns to 34:394/435 of 7apeA
Sites not aligning to the query:
8jadA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-17
26% identity, 85% coverage: 13:344/390 of query aligns to 21:393/434 of 8jadA
Sites not aligning to the query:
8jacA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-16
26% identity, 85% coverage: 13:344/390 of query aligns to 21:393/434 of 8jacA
- binding alpha-D-glucopyranose: N120 (≠ D104), W245 (= W233), L357 (≠ Y308)
- binding N-[[(2R,3S,4S,5R,6S)-3,4,5,6-tetrakis(oxidanyl)oxan-2-yl]methyl]ethanamide: D66 (= D56), N120 (≠ D104), E165 (= E159), G166 (= G160), W245 (= W233), G319 (= G270), G320 (= G271), R390 (= R341)
Sites not aligning to the query:
8ja9A Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-03
26% identity, 85% coverage: 13:344/390 of query aligns to 21:393/434 of 8ja9A
- binding alpha-D-glucopyranose: F247 (≠ Y235)
- binding (2~{S},3~{R},4~{S},5~{S},6~{S})-6-[(2-azanylhydrazinyl)methyl]oxane-2,3,4,5-tetrol: D66 (= D56), E165 (= E159), G166 (= G160), W245 (= W233), G319 (= G270), G320 (= G271), R390 (= R341)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_5112 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5112
VGAELQLCKEAVQAWSKQTGNNVEVVSTPNSATERLSFYQQILSAQSSDIDIIQIDMVWP
GMLAKHLLDLREVLPANATQGYFQAQVDNATVNGRLVTMPWFTDSGLLYYRKDLLEKYNQ
QVPRTWEEMTATARNIQQAERTAGNPNAWGYIFQGRAYEGLTCNALEWISSQPEGGLVNS
RGDIVVNSQASRTALTLAKSWVGDISPRGVLNYTEEEGRGVFQSGNALFMRNWPYVWALV
QGQDSAVKDKVGVAPLPRGGETGTHASTLGGWGLAVSRYSAHPKLAAELVSYLTSAQEQK
HRALIGAYNPVIESLYQDPELLAAMPYYAQLHSILNDGVMRPASITADRYPRVSNAFFDR
VHGVLAGELPVDQALAELESELTRIKRRNW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory