SitesBLAST
Comparing Pf1N1B4_549 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_549 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 97% coverage: 1:258/267 of query aligns to 1:264/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 97% coverage: 1:258/267 of query aligns to 1:261/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 97% coverage: 1:258/267 of query aligns to 1:258/262 of 6eb3C
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
27% identity, 97% coverage: 1:258/267 of query aligns to 1:260/261 of 2xuaH
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
25% identity, 95% coverage: 7:259/267 of query aligns to 9:268/269 of 5h3hB
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
26% identity, 96% coverage: 3:257/267 of query aligns to 9:273/276 of 4lyeA
- active site: G34 (≠ L28), G37 (≠ S31), N104 (≠ L92), A105 (≠ S93), M106 (= M94), M128 (≠ V116), R180 (= R166), D227 (= D212), H255 (= H239), W256 (≠ A240)
- binding (3e)-2,6-dioxo-6-phenylhex-3-enoate: G33 (= G27), G34 (≠ L28), G35 (= G29), N104 (≠ L92), A105 (≠ S93), L146 (≠ M139), L166 (= L152), R180 (= R166), M229 (≠ Y213), H255 (= H239), W256 (≠ A240)
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
26% identity, 96% coverage: 3:257/267 of query aligns to 9:273/276 of 4lxiA
- active site: G34 (≠ L28), G37 (≠ S31), N104 (≠ L92), A105 (≠ S93), M106 (= M94), M128 (≠ V116), R180 (= R166), D227 (= D212), H255 (= H239), W256 (≠ A240)
- binding (3E,5R)-5-fluoro-6-(2-fluorophenyl)-2,6-dioxohex-3-enoic acid: G33 (= G27), G34 (≠ L28), G35 (= G29), A38 (≠ T32), N43 (≠ D34), N104 (≠ L92), A105 (≠ S93), M106 (= M94), V149 (≠ L142), M150 (≠ L143), L166 (= L152), R180 (= R166), M229 (≠ Y213), W256 (≠ A240)
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
26% identity, 96% coverage: 3:257/267 of query aligns to 9:273/276 of 4lxhA
- active site: G34 (≠ L28), G37 (≠ S31), N104 (≠ L92), A105 (≠ S93), M106 (= M94), M128 (≠ V116), R180 (= R166), D227 (= D212), H255 (= H239), W256 (≠ A240)
- binding (2Z,4E)-3-chloro-2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid: G33 (= G27), G34 (≠ L28), G35 (= G29), N104 (≠ L92), A105 (≠ S93), M106 (= M94), L166 (= L152), W256 (≠ A240)
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
26% identity, 94% coverage: 8:258/267 of query aligns to 12:269/271 of 2d0dA
- active site: S32 (≠ L28), G33 (= G29), G35 (vs. gap), N100 (≠ L92), S101 (= S93), F102 (≠ M94), G125 (vs. gap), V140 (≠ D129), R172 (≠ L156), F185 (≠ I169), D222 (= D212), H250 (= H239), W251 (≠ A240)
- binding chloride ion: S32 (≠ L28), S101 (= S93), F102 (≠ M94)
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
25% identity, 96% coverage: 8:262/267 of query aligns to 13:274/276 of 1iunB
- active site: S33 (≠ L28), G34 (= G29), G36 (vs. gap), N101 (≠ L92), A102 (≠ S93), F103 (≠ M94), G126 (vs. gap), V141 (≠ D129), R173 (≠ L156), F186 (≠ I169), D223 (= D212), H251 (= H239), W252 (≠ A240)
- binding acetate ion: H244 (≠ V232), R260 (= R248)
7p4kA Soluble epoxide hydrolase in complex with fl217 (see paper)
24% identity, 93% coverage: 11:259/267 of query aligns to 22:310/313 of 7p4kA
- binding ~{N}-[[4-(cyclopropylsulfonylamino)-2-(trifluoromethyl)phenyl]methyl]-1-[(3-fluorophenyl)methyl]indole-5-carboxamide: F39 (≠ L28), D107 (≠ S93), W108 (≠ M94), M111 (≠ I97), P133 (vs. gap), Y149 (= Y130), M185 (= M145), Y232 (≠ G192), V264 (≠ T214), M269 (≠ K219), H290 (= H239)
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
25% identity, 94% coverage: 8:258/267 of query aligns to 12:269/271 of 1ukaA
- active site: S32 (≠ L28), G33 (= G29), G35 (vs. gap), N100 (≠ L92), A101 (≠ S93), F102 (≠ M94), G125 (vs. gap), V140 (≠ D129), R172 (≠ L156), F185 (≠ I169), D222 (= D212), H250 (= H239), W251 (≠ A240)
- binding 2-methylbutanoic acid: S32 (≠ L28), A101 (≠ S93), F102 (≠ M94), W141 (≠ Y130), V224 (≠ Y213), H250 (= H239)
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
25% identity, 94% coverage: 8:258/267 of query aligns to 12:269/271 of 1uk9A
- active site: S32 (≠ L28), G33 (= G29), G35 (vs. gap), N100 (≠ L92), A101 (≠ S93), F102 (≠ M94), G125 (vs. gap), V140 (≠ D129), R172 (≠ L156), F185 (≠ I169), D222 (= D212), H250 (= H239), W251 (≠ A240)
- binding isovaleric acid: S32 (≠ L28), A101 (≠ S93), F102 (≠ M94), W141 (≠ Y130), H250 (= H239)
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
25% identity, 94% coverage: 8:258/267 of query aligns to 12:269/271 of 1uk8A
- active site: S32 (≠ L28), G33 (= G29), G35 (vs. gap), N100 (≠ L92), A101 (≠ S93), F102 (≠ M94), G125 (vs. gap), V140 (≠ D129), R172 (≠ L156), F185 (≠ I169), D222 (= D212), H250 (= H239), W251 (≠ A240)
- binding pentanoic acid: S32 (≠ L28), A101 (≠ S93), F102 (≠ M94), L137 (≠ K126), W141 (≠ Y130), L231 (≠ E220), G234 (≠ V223), E235 (≠ K224), H250 (= H239)
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
25% identity, 94% coverage: 8:258/267 of query aligns to 12:269/271 of 1uk7A
- active site: S32 (≠ L28), G33 (= G29), G35 (vs. gap), N100 (≠ L92), A101 (≠ S93), F102 (≠ M94), G125 (vs. gap), V140 (≠ D129), R172 (≠ L156), F185 (≠ I169), D222 (= D212), H250 (= H239), W251 (≠ A240)
- binding butanoic acid: S32 (≠ L28), A101 (≠ S93), F102 (≠ M94), L137 (≠ K126), H250 (= H239)
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
25% identity, 94% coverage: 8:258/267 of query aligns to 12:269/271 of 1iupA
- active site: S32 (≠ L28), G33 (= G29), G35 (vs. gap), N100 (≠ L92), A101 (≠ S93), F102 (≠ M94), G125 (vs. gap), V140 (≠ D129), R172 (≠ L156), F185 (≠ I169), D222 (= D212), H250 (= H239), W251 (≠ A240)
- binding 2-methyl-propionic acid: S32 (≠ L28), A40 (≠ L33), N41 (≠ D34), Y74 (= Y66), W79 (≠ F71), A101 (≠ S93), F102 (≠ M94), L137 (≠ K126), W141 (≠ Y130), R172 (≠ L156), M188 (≠ R172), W196 (vs. gap), V224 (≠ Y213), H250 (= H239), W251 (≠ A240)
5fp0A Ligand complex structure of soluble epoxide hydrolase (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 249:540/543 of 5fp0A
- active site: F266 (≠ L28), H333 (≠ L92), D334 (≠ S93), W335 (≠ M94), N358 (= N117), N374 (≠ Q119), Y379 (vs. gap), Y462 (≠ A174), D492 (= D212), H520 (= H239)
- binding N-cyclopentyl-2-[4-(trifluoromethyl)phenyl]-3H-benzimidazole-4-sulfonamide: F266 (≠ L28), D334 (≠ S93), W335 (≠ M94), M338 (≠ I97), Y379 (vs. gap), Q380 (= Q121), Y462 (≠ A174), M499 (≠ K219), H520 (= H239)
7a7gA Soluble epoxide hydrolase in complex with tk90 (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 22:314/317 of 7a7gA
8qmzA Soluble epoxide hydrolase in complex with rk4 (see paper)
22% identity, 93% coverage: 11:259/267 of query aligns to 23:317/320 of 8qmzA
- binding (3~{a}~{R},6~{a}~{S})-~{N}-[(2,4-dichlorophenyl)methyl]-2-(4-methylphenyl)sulfonyl-3,3~{a},4,5,6,6~{a}-hexahydro-1~{H}-cyclopenta[c]pyrrole-5-carboxamide: D108 (≠ S93), W109 (≠ M94), M112 (≠ I97), Y156 (vs. gap), Q157 (= Q121), M192 (= M145), Y239 (≠ A174), V271 (≠ T214), L272 (≠ P215), H297 (= H239)
6yl4A Soluble epoxide hydrolase in complex with 3-((r)-3-(1-hydroxyureido) but-1-yn-1-yl)-n-((s)-3-phenyl-3-(4-trifluoromethoxy)phenyl)propyl) benzamide (see paper)
22% identity, 93% coverage: 11:259/267 of query aligns to 22:316/319 of 6yl4A
- active site: F39 (≠ L28), D107 (≠ S93), W108 (≠ M94), D268 (= D212), H296 (= H239)
- binding 3-[(3~{R})-3-[aminocarbonyl(oxidanyl)amino]but-1-ynyl]-~{N}-[(3~{S})-3-phenyl-3-[4-(trifluoromethyloxy)phenyl]propyl]benzamide: D107 (≠ S93), W108 (≠ M94), M111 (≠ I97), I147 (vs. gap), Y155 (vs. gap), Q156 (= Q121), L180 (≠ I134), M191 (= M145), Y238 (≠ A174), M241 (≠ H177), F269 (≠ Y213), V270 (≠ T214), H296 (= H239), W297 (≠ A240)
Query Sequence
>Pf1N1B4_549 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_549
MAYFEHEGCNLHYEEYGHGTPLLLVHGLGSSTLDWEMQIPALSAHYRVIVPDVRGHGRSD
KPRERYSIAGFSADLIALIEHLHLGPTHYVGLSMGGIIGFQLAVDQPQLLKSLCIVNSQP
QVKMQKPSDYWWLIKRWSMARLLSMETIGKALGRMLFPKPDQADLRQKIAVRWAKNHKHA
YLASFDALIGWGVQERLSRVTCPTLIVSADHDYTPVSVKETYVKLLPDARLVVIADSRHA
TPLDQPERFNQTLLEFLTAVDTTTQDH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory