Comparing Pf1N1B4_5645 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
34% identity, 82% coverage: 37:266/281 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
33% identity, 82% coverage: 37:266/281 of query aligns to 3:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
33% identity, 84% coverage: 29:265/281 of query aligns to 1:228/229 of 5t0wA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 77% coverage: 60:275/281 of query aligns to 36:240/243 of 5eyfB
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
30% identity, 84% coverage: 31:265/281 of query aligns to 3:227/229 of 6svfA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
27% identity, 86% coverage: 29:269/281 of query aligns to 5:242/251 of 1xt8B
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
29% identity, 75% coverage: 33:242/281 of query aligns to 6:211/247 of 2yjpA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
27% identity, 84% coverage: 30:264/281 of query aligns to 2:229/231 of 2v25A
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
27% identity, 83% coverage: 36:268/281 of query aligns to 1:224/226 of 8eyzA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
29% identity, 83% coverage: 33:265/281 of query aligns to 2:227/228 of 2y7iA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
28% identity, 81% coverage: 37:265/281 of query aligns to 3:226/234 of 3k4uE
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
30% identity, 62% coverage: 39:211/281 of query aligns to 5:173/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 62% coverage: 39:211/281 of query aligns to 27:195/260 of P02910
Sites not aligning to the query:
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
30% identity, 77% coverage: 28:242/281 of query aligns to 1:212/237 of 5kkwA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
30% identity, 60% coverage: 42:211/281 of query aligns to 30:195/260 of P0AEU0
Sites not aligning to the query:
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
31% identity, 73% coverage: 29:234/281 of query aligns to 2:197/240 of 4h5fA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 88% coverage: 27:272/281 of query aligns to 40:278/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 88% coverage: 27:272/281 of query aligns to 40:278/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 88% coverage: 27:272/281 of query aligns to 41:279/288 of 6h2tA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
27% identity, 81% coverage: 38:265/281 of query aligns to 1:222/224 of 4ymxA
>Pf1N1B4_5645 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5645
MHRRPLFKACVFLFAASAAVMGAAQAADSKLDSVLARGKLIVGTGSTNAPWHFQGADGKL
QGFDIDIARMVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVAF
TLPYYREGVGLLLPANSKYKEIDDLKAAGDGVIVAVLQNVYAEELVHQALPKAKVDQYDS
VDLMYQAVNSGRADAAATDQSSVKYLMVQNPGRYRSPAYAWSPQTYSCAVKRGDQDWLNF
VNTVLHEGMTGVEFPTYAASFKQWFGVDLPTPTIGFPVEFK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory