SitesBLAST
Comparing Pf6N2E2_1522 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1522 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
35% identity, 99% coverage: 1:325/327 of query aligns to 1:334/338 of Q8GIX7
- C38 (= C38) binding
- H61 (= H60) binding
- E62 (= E61) binding
- C92 (= C91) binding
- C95 (= C94) binding
- C98 (= C97) binding
- C106 (= C105) binding
- C148 (= C147) binding
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
35% identity, 99% coverage: 1:325/327 of query aligns to 1:334/345 of 4z6kA
- active site: C38 (= C38), H39 (≠ R39), T40 (= T40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), Q110 (≠ L109), C148 (= C147), T152 (≠ I151), R331 (≠ A322)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), C148 (= C147)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
34% identity, 99% coverage: 1:325/327 of query aligns to 1:334/336 of 6iqdA
- active site: C38 (= C38), T40 (= T40), H43 (= H43), H61 (= H60), C148 (= C147)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), C148 (= C147)
3s2fE Crystal structure of furx nadh:furfural
35% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2fE
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (≠ L109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding furfural: T42 (= T40), W51 (≠ L49), H63 (= H60), W89 (= W86), C150 (= C147), I287 (≠ A276)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (= T40), C150 (= C147), T154 (≠ I151), G174 (= G169), G176 (= G171), G177 (≠ A172), L178 (≠ A173), D197 (≠ T192), I198 (≠ R193), K202 (≠ G199), T239 (≠ F228), A240 (= A229), V241 (≠ P230), N262 (≠ A251), G263 (= G252), L264 (≠ I253), I287 (≠ A276), V288 (≠ N277), R333 (≠ A322)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
3s2fA Crystal structure of furx nadh:furfural
35% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2fA
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (≠ L109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding phosphorylisopropane: T42 (= T40), H63 (= H60), W89 (= W86), I287 (≠ A276)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
3s2eE Crystal structure of furx nadh complex 1
35% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2eE
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (≠ L109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (= T40), C150 (= C147), T154 (≠ I151), G176 (= G171), G177 (≠ A172), L178 (≠ A173), D197 (≠ T192), I198 (≠ R193), K202 (≠ G199), T239 (≠ F228), A240 (= A229), V241 (≠ P230), S242 (≠ V231), A245 (≠ L234), N262 (≠ A251), G263 (= G252), L264 (≠ I253), I287 (≠ A276), V288 (≠ N277)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
3s2eA Crystal structure of furx nadh complex 1
35% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2eA
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (≠ L109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
36% identity, 99% coverage: 1:325/327 of query aligns to 6:339/341 of 1lluA
- active site: C43 (= C38), H44 (≠ R39), T45 (= T40), H48 (= H43), H66 (= H60), E67 (= E61), C97 (= C91), C100 (= C94), C103 (= C97), C111 (= C105), Q115 (≠ L109), C153 (= C147), T157 (≠ I151), R336 (≠ A322)
- binding 1,2-ethanediol: H44 (≠ R39), T45 (= T40), L47 (= L42), D53 (≠ E48), W92 (= W86), C153 (= C147)
- binding nicotinamide-adenine-dinucleotide: C43 (= C38), H44 (≠ R39), T45 (= T40), H48 (= H43), C153 (= C147), T157 (≠ I151), G179 (= G171), G180 (≠ A172), L181 (≠ A173), D200 (≠ T192), I201 (≠ R193), K205 (≠ G199), A243 (≠ L237), V244 (vs. gap), S245 (vs. gap), A248 (vs. gap), V265 (≠ A251), L267 (≠ I253), I290 (≠ A276), V291 (≠ N277), R336 (≠ A322)
- binding zinc ion: C43 (= C38), H66 (= H60), C100 (= C94), C103 (= C97), C111 (= C105), C153 (= C147)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
33% identity, 99% coverage: 1:325/327 of query aligns to 1:334/337 of P12311
- C38 (= C38) mutation to S: No activity.
- T40 (= T40) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H43) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
32% identity, 99% coverage: 1:325/327 of query aligns to 1:334/339 of 1rjwA
- active site: C38 (= C38), H39 (≠ R39), T40 (= T40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), K110 (≠ L109), C148 (= C147), T152 (≠ I151), R331 (≠ A322)
- binding trifluoroethanol: T40 (= T40), C148 (= C147), I285 (≠ A276)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105)
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
32% identity, 99% coverage: 1:325/327 of query aligns to 1:334/337 of 3piiA
- active site: C38 (= C38), H39 (≠ R39), T40 (= T40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), K110 (≠ L109), C148 (= C147), T152 (≠ I151), R331 (≠ A322)
- binding butyramide: T40 (= T40), H61 (= H60), W87 (= W86), C148 (= C147)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), C148 (= C147)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
34% identity, 99% coverage: 1:325/327 of query aligns to 3:338/341 of 3meqA
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), L112 (= L109), C150 (= C147), T154 (≠ I151), R335 (≠ A322)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), C150 (= C147), T154 (≠ I151), G176 (= G171), G177 (≠ A172), L178 (≠ A173), D197 (≠ T192), I198 (≠ R193), K202 (≠ G199), T241 (≠ P236), A242 (≠ L237), V243 (vs. gap), S244 (vs. gap), A247 (vs. gap), N264 (≠ A251), G265 (= G252), L266 (≠ I253), I289 (≠ A276), V290 (≠ N277)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
32% identity, 99% coverage: 1:325/327 of query aligns to 8:340/344 of 6n7lC
- active site: C45 (= C38), T47 (= T40), H50 (= H43), H68 (= H60), C154 (= C147)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), H46 (≠ R39), T47 (= T40), H50 (= H43), C154 (= C147), T158 (≠ I151), G178 (= G169), G180 (= G171), G181 (≠ A172), L182 (≠ A173), D201 (≠ T192), V202 (≠ R193), K206 (≠ D197), T243 (≠ G232), A244 (≠ E233), V245 (≠ L234), S246 (≠ V235), A249 (= A238), N266 (≠ A251), G267 (= G252), L268 (≠ I253), I291 (≠ A276), V292 (≠ N277)
- binding zinc ion: C45 (= C38), H68 (= H60), C98 (= C91), C101 (= C94), C104 (= C97), C112 (= C105), C154 (= C147)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
35% identity, 99% coverage: 1:325/327 of query aligns to 4:333/336 of 6z42A
- active site: C41 (= C38), T43 (= T40), H46 (= H43), H64 (= H60), C148 (= C147)
- binding zinc ion: C41 (= C38), H64 (= H60), E65 (= E61), C95 (= C91), C98 (= C94), C101 (= C97), C109 (= C105), C148 (= C147)
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
33% identity, 100% coverage: 1:327/327 of query aligns to 1:347/347 of 2eerB
- active site: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), H68 (= H60), E69 (= E61), E98 (≠ W89), C101 (= C94), C104 (= C97), C112 (= C105), R116 (≠ L109), C154 (= C147), T158 (≠ I151), R342 (≠ A322)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), C154 (= C147), T158 (≠ I151), G178 (= G171), G181 (≠ A174), G182 (≠ H175), L183 (= L176), D203 (= D197), V204 (≠ L198), R205 (≠ G199), L247 (≠ F228), N248 (≠ A229), V270 (≠ A251), G271 (= G252), L272 (≠ I253), F273 (≠ H254), L295 (= L278), V296 (vs. gap), R342 (≠ A322)
- binding zinc ion: E98 (≠ W89), C101 (= C94), C104 (= C97), C112 (= C105)
5yatA Crystal structure of mitochondrial alcohol dehydrogenase isozyme iii from komagataella phaffii gs115 (see paper)
40% identity, 49% coverage: 2:160/327 of query aligns to 7:166/347 of 5yatA
- active site: C43 (= C38), T45 (= T40), H48 (= H43), H66 (= H60), C153 (= C147)
- binding zinc ion: C43 (= C38), H66 (= H60), E67 (= E61), C97 (= C91), C100 (= C94), C103 (= C97), C111 (= C105), C153 (= C147)
1r37A Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(h) and 2-ethoxyethanol (see paper)
32% identity, 100% coverage: 1:327/327 of query aligns to 1:347/347 of 1r37A
- active site: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), H68 (= H60), E69 (= E61), E98 (≠ W89), C101 (= C94), C104 (= C97), C112 (= C105), R116 (≠ L109), C154 (= C147), T158 (≠ I151), R342 (≠ A322)
- binding 2-ethoxyethanol: S40 (≠ T40), F49 (≠ L49)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), C154 (= C147), T158 (≠ I151), G181 (= G171), G182 (≠ A172), L183 (≠ A173), D203 (= D197), V204 (≠ L198), R205 (≠ G199), L247 (≠ F228), N248 (≠ A229), V270 (≠ A251), G271 (= G252), L272 (≠ I253), F273 (≠ H254), L295 (≠ V275), V296 (≠ A276), L334 (= L314), F337 (≠ G317), R342 (≠ A322)
- binding zinc ion: C38 (= C38), H68 (= H60), E98 (≠ W89), C101 (= C94), C104 (= C97), C112 (= C105), C154 (= C147)
1jvbA Alcohol dehydrogenase from the archaeon sulfolobus solfataricus (see paper)
32% identity, 100% coverage: 1:327/327 of query aligns to 1:347/347 of 1jvbA
- active site: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), H68 (= H60), E69 (= E61), E98 (≠ W89), C101 (= C94), C104 (= C97), C112 (= C105), R116 (≠ L109), C154 (= C147), T158 (≠ I151), R342 (≠ A322)
- binding zinc ion: C38 (= C38), H68 (= H60), E69 (= E61), E98 (≠ W89), C101 (= C94), C104 (= C97), C112 (= C105), C154 (= C147)
P39462 NAD-dependent alcohol dehydrogenase; EC 1.1.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 100% coverage: 1:327/327 of query aligns to 1:347/347 of P39462
- K11 (≠ Q11) modified: N6-methyllysine; partial
- K213 (≠ R204) modified: N6-methyllysine; partial
P00331 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADHII; YADH-2; EC 1.1.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 57% coverage: 2:188/327 of query aligns to 8:198/348 of P00331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
Query Sequence
>Pf6N2E2_1522 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1522
MRAMVLHTIGQPLQLEERPQPTPAAGQLLIKVQACGVCRTDLHLFDGELPQARLPRVPGH
EIVGEVTAVGAQVAPDWIGRRVGVPWLGWTCGVCEFCRSGRENLCDQALFTGCQLDGGYA
DYTVADARFCFPLPDTLEAAEAAPLLCAGLIGFRALQMAQNAPHLGLYGFGAAAHLAIQI
AVGRGQQVYAFTRPGDDLGQAYARSLGATWAGASDQLPPHLLDASLIFAPVGELVPLALQ
ATAKGGCVVCAGIHMSDIPAFPYRLLWQERSVRSVANLTRADGLAFFEQLQHTPVHCNVT
CYPLVQANQALEHLRSGQVNGAIVLIP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory