Comparing Pf6N2E2_1615 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
45% identity, 92% coverage: 1:306/331 of query aligns to 1:305/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
44% identity, 92% coverage: 1:306/331 of query aligns to 1:273/287 of 3v0sA
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 95% coverage: 10:324/331 of query aligns to 6:326/333 of O14295
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
36% identity, 94% coverage: 1:310/331 of query aligns to 1:310/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
35% identity, 94% coverage: 1:310/331 of query aligns to 1:310/333 of 1pz1A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
33% identity, 94% coverage: 1:311/331 of query aligns to 1:310/310 of P46336
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
34% identity, 93% coverage: 1:309/331 of query aligns to 2:274/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
34% identity, 93% coverage: 1:309/331 of query aligns to 2:274/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
34% identity, 93% coverage: 1:309/331 of query aligns to 1:273/274 of 5danA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
33% identity, 94% coverage: 2:311/331 of query aligns to 1:309/311 of 1pz0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
35% identity, 94% coverage: 1:310/331 of query aligns to 1:292/301 of 6ow0B
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
34% identity, 89% coverage: 13:307/331 of query aligns to 25:286/286 of 8hnqA
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 94% coverage: 1:310/331 of query aligns to 1:316/323 of 6ow0A
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
32% identity, 93% coverage: 1:307/331 of query aligns to 11:318/335 of 4aubB
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
32% identity, 93% coverage: 1:307/331 of query aligns to 12:305/315 of 3n6qD
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 92% coverage: 1:303/331 of query aligns to 12:288/297 of 4aubE
Sites not aligning to the query:
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
30% identity, 94% coverage: 1:311/331 of query aligns to 12:312/313 of 6hg6A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
35% identity, 64% coverage: 1:213/331 of query aligns to 2:206/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
35% identity, 64% coverage: 1:213/331 of query aligns to 2:206/298 of 1ynpB
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
33% identity, 94% coverage: 1:312/331 of query aligns to 13:315/315 of 5t79A
>Pf6N2E2_1615 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1615
MKTRQLGHHGPHVSSIGLGCMGMSDFYTTGVDEREAIATLHRAVELGVTLFDTADMYGPY
TNEELLGRALRGKRENLYLASKFGLVRSSDPHARGVNGRPDYVRQSVDGSLKRLDTDYLD
LYYQHRIDPEVPVEETIGAMAELVKAGKVRHIGISEASAETIERAHAVHPLAAVQSEYSL
WSRDPEHNGVLDTCRRLGIAFVAYSPLGRGFLTGELKSPEDFAADDYRRFNPRFQADNFN
RNLVLVEQVKALALDKGISAAQLALAWVLAQGDHVIPIPGTKQRKYLESNVAATSVMLSA
GELARLDGIFAGEGAVAGDRYQAHTMTLLNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory