SitesBLAST
Comparing Pf6N2E2_1646 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1646 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 12:402/404 of 6jahA
- binding (2S)-heptane-1,2,7-triol: Y309 (≠ A356), E310 (≠ Q357), K313 (= K360), R332 (≠ P379)
- binding propane-2,2-diol: D160 (≠ N207), W162 (= W209)
- binding alpha-D-glucopyranose: D68 (= D116), D116 (= D164), G173 (= G220), E228 (= E275), W246 (= W293), G283 (= G330), G284 (= G331), W285 (= W332), R354 (= R401)
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 12:402/404 of 6jagA
- binding beta-D-fructofuranose: R47 (= R95), F114 (= F162), D116 (= D164), E228 (= E275), W246 (= W293), W285 (= W332), R321 (≠ Y368)
- binding alpha-D-glucopyranose: D68 (= D116), D116 (= D164), G173 (= G220), E228 (= E275), W246 (= W293), G283 (= G330), G284 (= G331), W285 (= W332), R354 (= R401)
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 12:402/404 of 6jadA
- binding alpha-D-glucopyranose: D68 (= D116), D116 (= D164), G173 (= G220), E228 (= E275), W246 (= W293), G283 (= G330), G284 (= G331), W285 (= W332), R354 (= R401)
- binding alpha-D-fructofuranose: R47 (= R95), F114 (= F162), D116 (= D164), Y248 (= Y295), W285 (= W332)
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 12:402/404 of 6j9yA
- binding carbonate ion: E373 (≠ Q420), K382 (≠ R429), D390 (≠ E437)
- binding alpha-D-glucopyranose: A42 (≠ N90), R47 (= R95), D68 (= D116), D116 (= D164), D116 (= D164), G173 (= G220), E228 (= E275), W246 (= W293), G283 (= G330), G284 (= G331), W285 (= W332), W285 (= W332), R321 (≠ Y368), R354 (= R401)
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 14:404/406 of 6jamA
- binding alpha-D-glucopyranose: T46 (≠ A92), R49 (= R95), D70 (= D116), F116 (= F162), D118 (= D164), D118 (= D164), G175 (= G220), E230 (= E275), W248 (= W293), Y250 (= Y295), G285 (= G330), G286 (= G331), W287 (= W332), W287 (= W332)
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 12:402/404 of 6jaiA
- binding calcium ion: P247 (= P294), Y248 (= Y295), R321 (≠ Y368)
- binding alpha-D-glucopyranose: V13 (= V61), T44 (≠ A92), D68 (= D116), G173 (= G220), E228 (= E275), W246 (= W293), G283 (= G330), G284 (= G331), W285 (= W332), W285 (= W332), R321 (≠ Y368), R354 (= R401)
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
45% identity, 87% coverage: 60:449/450 of query aligns to 12:402/404 of 6jb0A
- binding alpha-D-glucopyranose: T44 (≠ A92), R47 (= R95), D68 (= D116), F114 (= F162), D116 (= D164), D116 (= D164), G173 (= G220), E228 (= E275), W246 (= W293), W246 (= W293), Y248 (= Y295), G283 (= G330), G284 (= G331), R354 (= R401)
- binding 1,3-propandiol: E15 (≠ A63), R318 (≠ V365)
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
38% identity, 87% coverage: 51:442/450 of query aligns to 1:387/391 of 6dtqA
- binding alpha-D-glucopyranose: V11 (= V61), E14 (= E64), R46 (= R95), D67 (= D116), D115 (= D164), D115 (= D164), G166 (= G220), E222 (= E275), W240 (= W293), W240 (= W293), G277 (= G331), W278 (= W332), W278 (= W332), Q316 (≠ Y368), R349 (= R401)
- binding magnesium ion: T59 (≠ S108), D60 (= D109), D62 (= D111), E290 (≠ N342)
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
33% identity, 88% coverage: 52:448/450 of query aligns to 4:407/407 of 1eu8A
- binding alpha-D-glucopyranose: G12 (≠ A60), E16 (= E64), T43 (≠ N90), T45 (≠ A92), R48 (= R95), D69 (= D116), Y120 (≠ F162), D122 (= D164), G178 (= G220), E238 (= E275), W256 (= W293), Y258 (= Y295), G292 (= G330), G293 (= G331), W294 (= W332), R363 (= R401)
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
32% identity, 90% coverage: 42:448/450 of query aligns to 25:448/450 of Q7LYW7
- E57 (= E64) binding
- T84 (≠ N90) binding
- R89 (= R95) binding
- D110 (= D116) binding
- Y161 (≠ F162) binding
- D163 (= D164) binding
- Y217 (= Y218) binding
- E279 (= E275) binding
- W297 (= W293) binding
- Y299 (= Y295) binding
- G334 (= G331) binding
- W335 (= W332) binding
- W371 (≠ Y368) binding
- R404 (= R401) binding
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
32% identity, 93% coverage: 30:447/450 of query aligns to 3:416/416 of A9CEY9
- Q40 (vs. gap) binding
- H41 (vs. gap) binding
- S71 (≠ A92) binding
- D95 (= D116) binding
- D141 (= D164) binding
- G194 (= G220) binding
- T248 (≠ E275) binding
- G303 (= G331) binding ; binding
- W304 (= W332) binding ; binding
- R373 (= R401) binding ; binding
7qhvAAA Sulfoquinovosyl binding protein (see paper)
33% identity, 83% coverage: 76:447/450 of query aligns to 26:386/390 of 7qhvAAA
- binding [(2~{S},3~{S},4~{S},5~{R},6~{S})-6-[(2~{S})-3-butanoyloxy-2-heptanoyloxy-propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: N40 (= N90), T41 (≠ S91), S42 (≠ A92), D66 (= D116), F109 (= F162), D111 (= D164), E163 (= E219), G164 (= G220), A217 (≠ T274), T218 (≠ E275), D219 (≠ E276), W236 (= W293), G272 (= G330), G273 (= G331), W274 (= W332), R343 (= R401)
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
33% identity, 83% coverage: 76:447/450 of query aligns to 27:388/389 of 7ofyA
- binding [(2S,3S,4S,5R,6S)-6-[(2R)-2,3-bis(oxidanyl)propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T42 (≠ S91), S43 (≠ A92), D67 (= D116), D113 (= D164), G166 (= G220), T220 (≠ E275), W238 (= W293), Y240 (= Y295), G274 (= G330), G275 (= G331), W276 (= W332), R345 (= R401)
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
33% identity, 82% coverage: 76:445/450 of query aligns to 25:384/384 of 7yzsAAA
- binding 6-deoxy-6-sulfo-beta-D-glucopyranose: T40 (≠ S91), S41 (≠ A92), D65 (= D116), D111 (= D164), E163 (= E219), G164 (= G220), T218 (≠ E275), W236 (= W293), G272 (= G330), G273 (= G331), W274 (= W332), R343 (= R401)
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
33% identity, 82% coverage: 76:445/450 of query aligns to 24:381/382 of 7yzuA
- binding [(2S,3S,4S,5R,6S)-6-methoxy-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T39 (≠ S91), S40 (≠ A92), D64 (= D116), D110 (= D164), E162 (= E219), G163 (= G220), T215 (≠ E275), W233 (= W293), G269 (= G330), G270 (= G331), W271 (= W332), R340 (= R401)
Sites not aligning to the query:
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
26% identity, 72% coverage: 83:404/450 of query aligns to 67:427/471 of G7CES0
- Q79 (≠ E94) binding ; mutation to A: About 10-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- D100 (= D116) binding ; mutation to A: Structurally unstable.
- N154 (≠ D164) binding ; mutation to A: About 100-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- Y198 (= Y218) binding
- E261 (= E275) mutation to A: Loss of trehalose-binding.
- W279 (= W293) binding ; mutation to A: Loss of trehalose-binding.
- Y281 (= Y295) binding
- G354 (= G331) binding
- L355 (≠ W332) mutation to A: About 13-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- C375 (≠ Y352) modified: Disulfide link with 57
- R424 (= R401) binding ; mutation to A: Loss of trehalose-binding.
Sites not aligning to the query:
- 45 binding ; N→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; N→T: Increased trehalose-binding; when associated with D-46.
- 46 binding ; E→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; E→D: Increased trehalose-binding; when associated with T-45.
- 57 modified: Disulfide link with 375
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
27% identity, 72% coverage: 83:404/450 of query aligns to 34:394/435 of 7apeA
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
23% identity, 77% coverage: 99:445/450 of query aligns to 43:398/399 of 5iaiA
Sites not aligning to the query:
8jadA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-17
25% identity, 72% coverage: 82:404/450 of query aligns to 32:393/434 of 8jadA
Sites not aligning to the query:
8jacA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-16
25% identity, 72% coverage: 82:404/450 of query aligns to 32:393/434 of 8jacA
- binding alpha-D-glucopyranose: N120 (≠ D164), W245 (= W293), L357 (≠ Y368)
- binding N-[[(2R,3S,4S,5R,6S)-3,4,5,6-tetrakis(oxidanyl)oxan-2-yl]methyl]ethanamide: D66 (= D116), N120 (≠ D164), E165 (= E219), G166 (= G220), W245 (= W293), G319 (= G330), G320 (= G331), R390 (= R401)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_1646 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1646
MPHRKYTATFGDVNVNFSKNKNKEGFMKQLKSILPAALLGLCVGFPSLCTAASLTISCGA
VGAELQLCKEAVEAWSKQTGNSVEVVSTPNSATERLSFYQQILSAQSSDIDIIQIDMVWP
GMLAKHLMDLREVLPANATQGYFQAQVDNATVNGRLVTMPWFTDSGLLYYRKDLLEKYNK
PVPQTWEEMTTTARAVQQAERAAGNANAWGYVFQGRAYEGLTCNALEWISSQPQGGLVNQ
QGDIVVNSQASRAALTLAKSWVGDISPRGVLNYTEEEGRGVFQSGNALFMRNWPYVWALV
QSQDSVVKDKVGVAPLPRGGETGTHASTLGGWGLAVSRYSANPKLAAELVSYLSSAQQQK
HRALVGAYNPVIESLYQDPELLAAMPYYSQLRSILNDGVMRPASITADRYPRVSNAFFDQ
VHGVLADERPVDQALAELESELTRIKRRNW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory