Comparing Pf6N2E2_1718 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
48% identity, 96% coverage: 3:188/194 of query aligns to 2:185/187 of P00903
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 96% coverage: 3:189/194 of query aligns to 75:265/276 of Q42565
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
36% identity, 99% coverage: 3:194/194 of query aligns to 4:193/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
36% identity, 99% coverage: 3:194/194 of query aligns to 3:192/192 of 1i7qB
Q9LVW7 Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 96% coverage: 2:188/194 of query aligns to 240:420/430 of Q9LVW7
7yc6A GMP synthase [glutamine-hydrolyzing] subunit A
27% identity, 96% coverage: 3:189/194 of query aligns to 2:176/183 of 7yc6A
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
32% identity, 68% coverage: 44:174/194 of query aligns to 230:355/379 of 1ce8B
Sites not aligning to the query:
1jdbF Carbamoyl phosphate synthetase from escherichia coli (see paper)
32% identity, 68% coverage: 44:174/194 of query aligns to 230:355/380 of 1jdbF
Sites not aligning to the query:
3r75B Crystal structure of 2-amino-2-desoxyisochorismate synthase (adic) synthase phze from burkholderia lata 383 in complex with benzoate, pyruvate, glutamine and contaminating zn2+ (see paper)
30% identity, 92% coverage: 2:180/194 of query aligns to 432:606/622 of 3r75B
Sites not aligning to the query:
P05990 CAD protein; Protein rudimentary; EC 6.3.5.5; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
28% identity, 69% coverage: 40:173/194 of query aligns to 226:355/2224 of P05990
Sites not aligning to the query:
P27708 CAD protein; EC 6.3.5.5; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
29% identity, 63% coverage: 51:173/194 of query aligns to 219:338/2225 of P27708
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
21% identity, 97% coverage: 2:189/194 of query aligns to 7:197/501 of 1gpmA
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
22% identity, 96% coverage: 3:188/194 of query aligns to 28:207/693 of P49915
Sites not aligning to the query:
P08955 CAD protein; EC 6.3.5.5; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
27% identity, 65% coverage: 47:173/194 of query aligns to 215:338/2225 of P08955
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
23% identity, 96% coverage: 3:188/194 of query aligns to 6:182/658 of 2vxoB
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
24% identity, 96% coverage: 3:188/194 of query aligns to 2:181/475 of 2ywcA
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
23% identity, 96% coverage: 2:188/194 of query aligns to 5:188/490 of 5tw7F
Sites not aligning to the query:
P20054 Protein PYR1-3; EC 6.3.5.5; EC 2.1.3.2; EC 3.5.2.3 from Dictyostelium discoideum (Social amoeba)
30% identity, 73% coverage: 47:188/194 of query aligns to 238:379/2225 of P20054
Sites not aligning to the query:
6w2jB Cps1 bound to allosteric inhibitor h3b-374 (see paper)
27% identity, 74% coverage: 47:189/194 of query aligns to 215:357/1364 of 6w2jB
Sites not aligning to the query:
6w2jA Cps1 bound to allosteric inhibitor h3b-374 (see paper)
27% identity, 74% coverage: 47:189/194 of query aligns to 215:357/1422 of 6w2jA
Sites not aligning to the query:
>Pf6N2E2_1718 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1718
VKVFLIDAYDSFVFIISQYLEQLGLETHVERHDVPDLIQRIEAFSPDFCVLGPGPGHPAD
VGYIEVIRHFQGRLPLLGVCLGHQAIGLAFGAQVCRAPHVMHGKVSTIENDGKGVYDHTQ
AQAIRATRYHSLMISEQPLPDCLEITSRSTDDGYVMGVRHRHLPVEGVQFHPESILTENG
LDLFRSFIRCHVHK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory