Comparing Pf6N2E2_240 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 97% coverage: 1:287/296 of query aligns to 71:380/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 97% coverage: 1:287/296 of query aligns to 71:380/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
45% identity, 64% coverage: 1:188/296 of query aligns to 71:260/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 65% coverage: 1:193/296 of query aligns to 62:250/378 of P69874
Sites not aligning to the query:
1g291 Malk (see paper)
45% identity, 65% coverage: 30:222/296 of query aligns to 81:270/372 of 1g291
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 74% coverage: 1:219/296 of query aligns to 47:259/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 74% coverage: 1:219/296 of query aligns to 47:259/371 of 3puyA
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 74% coverage: 1:219/296 of query aligns to 47:259/371 of 3puxA
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 74% coverage: 1:219/296 of query aligns to 47:259/371 of 3puwA
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 74% coverage: 1:219/296 of query aligns to 47:259/371 of 3puvA
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
38% identity, 74% coverage: 1:219/296 of query aligns to 45:257/367 of 1q12A
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 74% coverage: 1:219/296 of query aligns to 48:260/371 of P68187
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
43% identity, 66% coverage: 1:196/296 of query aligns to 51:248/375 of 2d62A
Sites not aligning to the query:
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 64% coverage: 31:219/296 of query aligns to 45:229/344 of 2awnC
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 73% coverage: 1:217/296 of query aligns to 48:258/369 of P19566
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 72% coverage: 1:214/296 of query aligns to 49:260/393 of P9WQI3
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 77% coverage: 1:227/296 of query aligns to 46:272/384 of 8hplC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
36% identity, 77% coverage: 1:227/296 of query aligns to 48:274/362 of 8hprD
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
36% identity, 77% coverage: 1:227/296 of query aligns to 48:274/363 of 8hprC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 65% coverage: 2:193/296 of query aligns to 48:238/241 of 4u00A
Sites not aligning to the query:
>Pf6N2E2_240 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_240
MINRLDTQDSGRISVNGVATDELDVVTLRRGIGFMMQSSALFPHQTVAENIGAVPRLLGW
SKHKIRQRVSELISLVGLQPEFLDRYPNQLSGGQQSRVALARALASDPPVVLMDEPFAAL
DPVIRERLQDELVALQRRLHKTIILVTHDMEEAIKIGDRIAIFEGEGKLAQFDTPHNILA
HPASEFVKNFIGKDPLLKRLSLMKVSDLPVDEVNCEFKLLLDDKSNPLKWVSESDLPVPE
LTTVSNNDSLHHALVKILTAPLGVVVRVDEAGGYEGCLSIASFHSALNERRFGSAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory