Comparing Pf6N2E2_5281 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5281 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
25% identity, 85% coverage: 36:290/300 of query aligns to 65:307/310 of 6i8wB
Sites not aligning to the query:
5w15D Crystal structure of an alpha/beta hydrolase fold protein from burkholderia ambifaria.
38% identity, 40% coverage: 18:136/300 of query aligns to 11:124/270 of 5w15D
Sites not aligning to the query:
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 88% coverage: 21:285/300 of query aligns to 7:261/265 of 6eb3A
Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase; HOPDA; EC 3.7.1.13 from Pseudomonas resinovorans (see paper)
24% identity, 88% coverage: 22:286/300 of query aligns to 25:278/290 of Q9AQM4
1d07A Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution (see paper)
32% identity, 37% coverage: 15:124/300 of query aligns to 8:120/293 of 1d07A
Sites not aligning to the query:
1k6eA Complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,2-propanediol (product of dehalogenation of 1,2-dibromopropane) at 1.85a (see paper)
32% identity, 37% coverage: 15:124/300 of query aligns to 10:122/295 of 1k6eA
Sites not aligning to the query:
1k63A Complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis with ut26 2-bromo-2-propene-1-ol at 1.8a resolution (see paper)
32% identity, 37% coverage: 15:124/300 of query aligns to 10:122/295 of 1k63A
Sites not aligning to the query:
1g5fA Structure of linb complexed with 1,2-dichloroethane (see paper)
32% identity, 37% coverage: 15:124/300 of query aligns to 9:121/294 of 1g5fA
Sites not aligning to the query:
1g4hA Linb complexed with butan-1-ol (see paper)
32% identity, 37% coverage: 15:124/300 of query aligns to 9:121/294 of 1g4hA
Sites not aligning to the query:
1g42A Structure of 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase (linb) from sphingomonas paucimobilis complexed with 1,2-dichloropropane (see paper)
32% identity, 37% coverage: 15:124/300 of query aligns to 9:121/294 of 1g42A
Sites not aligning to the query:
D4Z2G1 Haloalkane dehalogenase; 1,3,4,6-tetrachloro-1,4-cyclohexadiene halidohydrolase; 1,4-TCDN halidohydrolase; EC 3.8.1.5 from Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S) (Sphingobium japonicum) (see 6 papers)
32% identity, 37% coverage: 15:124/300 of query aligns to 11:123/296 of D4Z2G1
Sites not aligning to the query:
6kxhB Alp1u_y247f mutant in complex with fluostatin c (see paper)
38% identity, 39% coverage: 14:130/300 of query aligns to 19:133/294 of 6kxhB
Sites not aligning to the query:
4c6hA Haloalkane dehalogenase with 1-hexanol (see paper)
25% identity, 63% coverage: 11:199/300 of query aligns to 4:225/291 of 4c6hA
Sites not aligning to the query:
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 88% coverage: 21:285/300 of query aligns to 7:264/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
41% identity, 36% coverage: 21:127/300 of query aligns to 7:111/262 of 6eb3C
4nvrA 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
31% identity, 39% coverage: 21:136/300 of query aligns to 23:138/302 of 4nvrA
Sites not aligning to the query:
4k2aC Crystal structure of haloalkane dehalogenase dbea from bradyrhizobium elkani usda94 (see paper)
34% identity, 33% coverage: 22:121/300 of query aligns to 11:110/299 of 4k2aC
Sites not aligning to the query:
Q1JU72 Fluoroacetate dehalogenase; EC 3.8.1.3 from Burkholderia sp. (see paper)
33% identity, 36% coverage: 24:130/300 of query aligns to 16:125/304 of Q1JU72
Sites not aligning to the query:
6u2mA Crystal structure of a halotag-based calcium indicator, halocamp v2, bound to jf635 (see paper)
26% identity, 59% coverage: 22:198/300 of query aligns to 192:374/464 of 6u2mA
Sites not aligning to the query:
3r3zA Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate (see paper)
34% identity, 30% coverage: 29:118/300 of query aligns to 29:121/304 of 3r3zA
Sites not aligning to the query:
>Pf6N2E2_5281 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5281
MPLAQIPLRIWRQRSQIFMFRGHAIRYWVAGQGEPLLLIHGFPTASWDWHYLWQPLAQRY
RVIACDMLGFGDSAKPTDHVYSLLEQADLQQALLAHLNVRGALHVLAHDYGDSVAQELLA
RHYEARIHLASCVFLNGGLFPETHRPVWAQKLLLSPLGWLLGRAFSRESLVSSFRQIFGP
RTTPTESELDDFWSLVEAHRGPRIMHKLIAYIPERRVQRDRWVQAMQRGDVPLRVIDGAV
DPISGEHMVARYEALIPSPDTVLLPDIGHYPHTEAPVQVLKHYLAFREAIAAPHRQMACS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory