SitesBLAST
Comparing PfGW456L13_1122 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1122 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
93% identity, 100% coverage: 1:399/399 of query aligns to 1:399/399 of P46154
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
93% identity, 99% coverage: 3:398/399 of query aligns to 1:396/396 of 1kolA
- active site: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), H66 (= H68), E67 (= E69), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), N114 (= N116), D168 (= D170), T172 (= T174), K385 (= K387)
- binding nicotinamide-adenine-dinucleotide: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), F92 (= F94), D168 (= D170), T172 (= T174), G192 (= G194), G194 (= G196), P195 (= P197), V196 (= V198), D216 (= D218), L217 (≠ V219), R221 (= R223), A260 (= A262), V261 (= V263), R266 (= R268), H268 (= H270), V281 (= V283), P298 (= P300), L300 (= L302), Q336 (= Q338), T337 (= T339)
- binding zinc ion: C45 (= C47), H66 (= H68), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), D168 (= D170)
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
87% identity, 99% coverage: 3:396/399 of query aligns to 1:394/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), D168 (= D170), T172 (= T174), G194 (= G196), P195 (= P197), V196 (= V198), D216 (= D218), R221 (= R223), V261 (= V263), R266 (= R268), H268 (= H270), V281 (= V283), P298 (= P300), L300 (= L302), Q336 (= Q338), T337 (= T339)
- binding zinc ion: C45 (= C47), H66 (= H68), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), D168 (= D170)
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
59% identity, 99% coverage: 1:397/399 of query aligns to 1:397/399 of Q52078
Sites not aligning to the query:
- 2:399 modified: mature protein, Formaldehyde dismutase
2dphA Crystal structure of formaldehyde dismutase
59% identity, 99% coverage: 2:397/399 of query aligns to 1:396/398 of 2dphA
- active site: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), H66 (= H68), E67 (= E69), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), L114 (vs. gap), S168 (= S169), D169 (= D170), P172 (= P173), K386 (= K387)
- binding nicotinamide-adenine-dinucleotide: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), F92 (= F94), D169 (= D170), T173 (= T174), A192 (= A193), G193 (= G194), G195 (= G196), P196 (= P197), V197 (= V198), G216 (= G217), D217 (= D218), Q218 (≠ V219), R222 (= R223), L236 (= L237), V262 (= V263), H267 (≠ R268), P298 (= P300), G299 (= G301), I300 (≠ L302), A337 (≠ T339)
- binding zinc ion: C45 (= C47), H66 (= H68), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), D169 (= D170)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
30% identity, 94% coverage: 5:381/399 of query aligns to 2:334/346 of 4cpdA
- active site: C38 (= C47), G39 (= G48), S40 (= S49), H43 (= H52), H59 (= H68), E60 (= E69), C89 (= C98), C92 (= C101), C95 (= C104), C103 (= C112), G107 (= G122), D152 (= D170), T156 (= T174)
- binding nicotinamide-adenine-dinucleotide: G39 (= G48), S40 (= S49), T156 (= T174), G178 (= G196), P179 (= P197), V180 (= V198), D200 (= D218), R201 (≠ V219), R205 (= R223), A243 (= A262), V244 (= V263), V266 (≠ P300), V268 (= V311), L292 (≠ Q338), A293 (≠ T339), F333 (= F380)
- binding zinc ion: C38 (= C47), H59 (= H68), C89 (= C98), C92 (= C101), C95 (= C104), C103 (= C112), D152 (= D170)
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
35% identity, 67% coverage: 1:267/399 of query aligns to 2:246/348 of 5ylnA
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
33% identity, 54% coverage: 37:250/399 of query aligns to 28:227/341 of P07913
- C38 (= C47) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
28% identity, 90% coverage: 37:394/399 of query aligns to 30:347/347 of 3gfbA
- active site: C40 (= C47), G41 (= G48), T42 (≠ S49), H45 (= H52), H65 (= H68), E66 (= E69), C95 (= C98), C98 (= C101), C101 (= C104), C109 (= C112), K113 (≠ N116), P151 (≠ C167), A155 (≠ I171), K340 (= K387)
- binding nicotinamide-adenine-dinucleotide: G173 (= G194), G175 (= G196), P176 (= P197), L177 (≠ V198), S196 (≠ G217), E197 (≠ D218), P198 (≠ V219), R202 (= R223), F241 (≠ H277), S242 (≠ E278), A244 (≠ P280), L264 (≠ P300), G265 (= G301), L266 (= L302), I289 (≠ W328), T290 (≠ A329)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
28% identity, 90% coverage: 37:394/399 of query aligns to 32:349/350 of Q5JI69
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
31% identity, 69% coverage: 37:311/399 of query aligns to 32:273/348 of O58389
- C42 (= C47) binding
- T44 (≠ S49) mutation to A: Total loss of enzymatic activity.
- H67 (= H68) binding
- E68 (= E69) binding
- C97 (= C98) binding
- C100 (= C101) binding
- C103 (= C104) binding
- C111 (= C112) binding
- E152 (≠ D170) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V198) binding
- E199 (≠ D218) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R223) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ PGL 300:302) binding
Sites not aligning to the query:
- 291:292 binding
- 294 R→A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
31% identity, 69% coverage: 37:311/399 of query aligns to 30:271/346 of 2dfvA
- active site: C40 (= C47), G41 (= G48), T42 (≠ S49), H45 (= H52), H65 (= H68), E66 (= E69), C95 (= C98), C98 (= C101), C101 (= C104), C109 (= C112), K113 (≠ N116), P151 (≠ I171), A155 (≠ G175)
- binding nicotinamide-adenine-dinucleotide: G175 (= G196), P176 (= P197), L177 (≠ V198), E197 (≠ D218), P198 (≠ V219), R202 (= R223), F241 (≠ A267), S242 (≠ R268), A244 (= A279), L264 (≠ P300), G265 (= G301), L266 (= L302)
- binding zinc ion: C95 (= C98), C101 (= C104), C109 (= C112)
Sites not aligning to the query:
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
33% identity, 49% coverage: 37:231/399 of query aligns to 27:206/339 of 5kiaA
- active site: C37 (= C47), G38 (= G48), T39 (≠ S49), H42 (= H52), H61 (= H68), E62 (= E69), C91 (= C98), C94 (= C101), C97 (= C104), C105 (= C112), V109 (= V127), P147 (≠ I171), A151 (≠ G175)
- binding calcium ion: D146 (= D170), N150 (≠ T174)
- binding zinc ion: C91 (= C98), C94 (= C101), C97 (= C104), C105 (= C112)
Sites not aligning to the query:
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
29% identity, 66% coverage: 2:263/399 of query aligns to 1:260/357 of 7y9pA
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
34% identity, 58% coverage: 34:264/399 of query aligns to 24:244/351 of 3fplA
- active site: C37 (= C47), T38 (≠ G48), S39 (= S49), H42 (= H52), H59 (= H68), E60 (= E69), D89 (≠ C98), S92 (≠ C101), V95 (≠ M107), S103 (≠ V115), D150 (= D170), T154 (= T174)
- binding zinc ion: C37 (= C47), H59 (= H68), D150 (= D170)
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
34% identity, 57% coverage: 38:264/399 of query aligns to 29:245/344 of 7xy9A
Sites not aligning to the query:
1u3wA Crystal structure of human alcohol dehydrogenase gamma-2-gamma-2 isoform complexed with n-1-methylheptylformamide determined to 1.45 angstrom resolution (see paper)
32% identity, 49% coverage: 35:231/399 of query aligns to 34:236/374 of 1u3wA
- active site: C46 (= C47), R47 (≠ G48), S48 (= S49), H51 (= H52), H67 (= H68), E68 (= E69), C97 (= C98), C100 (= C101), C103 (= C104), C111 (= C112), D115 (≠ N116), C174 (vs. gap), T178 (= T174)
- binding 1-methylheptylformamide: S48 (= S49), H67 (= H68), F93 (= F94), C174 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: C46 (= C47), R47 (≠ G48), S48 (= S49), H51 (= H52), C174 (vs. gap), T178 (= T174), G199 (= G194), G201 (= G196), V203 (= V198), D223 (= D218), I224 (≠ V219), K228 (≠ R223)
- binding zinc ion: C46 (= C47), H67 (= H68), C97 (= C98), C100 (= C101), C103 (= C104), C111 (= C112), C174 (vs. gap)
Sites not aligning to the query:
P00326 Alcohol dehydrogenase 1C; Alcohol dehydrogenase subunit gamma; EC 1.1.1.1 from Homo sapiens (Human) (see 5 papers)
32% identity, 49% coverage: 35:231/399 of query aligns to 35:237/375 of P00326
- C47 (= C47) binding
- R48 (≠ G48) to H: in dbSNP:rs35385902
- H68 (= H68) binding
- C98 (= C98) binding
- C101 (= C101) binding
- C104 (= C104) binding
- C112 (= C112) binding
- P166 (≠ C167) to S: in dbSNP:rs34195308
- C175 (vs. gap) binding
- GLGGVG 200:205 (≠ GAGPVG 194:199) binding
- D224 (= D218) binding
- K229 (≠ R223) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
- 272 R → Q: in allele ADH3*2/gamma-2; dbSNP:rs1693482
- 293:295 binding
- 318:320 binding
- 350 I → V: in allele ADH3*2/gamma-2; dbSNP:rs698
- 352 P → T: in dbSNP:rs35719513
- 370 binding
P25405 Alcohol dehydrogenase 1A; Alcohol dehydrogenase I-A; ADH IA; EC 1.1.1.1 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
31% identity, 58% coverage: 35:264/399 of query aligns to 34:271/375 of P25405
Sites not aligning to the query:
- 1 modified: N-acetylglycine
1u3tA Crystal structure of human alcohol dehydrogenase alpha-alpha isoform complexed with n-cyclopentyl-n-cyclobutylformamide determined to 2.5 angstrom resolution (see paper)
32% identity, 49% coverage: 35:231/399 of query aligns to 34:236/374 of 1u3tA
- active site: C46 (= C47), G47 (= G48), T48 (≠ S49), H51 (= H52), H67 (= H68), E68 (= E69), C97 (= C98), C100 (= C101), C103 (= C104), C111 (= C112), D115 (≠ N116), C174 (= C167), T178 (= T174)
- binding cyclobutyl(cyclopentyl)formamide: T48 (≠ S49), H67 (= H68), A93 (≠ N95), I94 (≠ V96)
- binding nicotinamide-adenine-dinucleotide: C46 (= C47), T48 (≠ S49), H51 (= H52), C174 (= C167), T178 (= T174), L200 (≠ A195), G201 (= G196), V203 (= V198), D223 (= D218), I224 (≠ V219)
- binding zinc ion: C46 (= C47), H67 (= H68), C97 (= C98), C100 (= C101), C103 (= C104), C111 (= C112), C174 (= C167)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_1122 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1122
MSGNRGVVYLGAGKVEVQKIDYPKMQDPRGRKINHAVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLSVNPARP
GGAYGYVDMGDWTGGQAEYAMVPYADFNLLKLPDRDRAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNTVRLAHAKAQGFEIADLSLD
TPLHEQIAALLGEPEVDCAIDAVGFEARGHGHDGVKHEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRINIA
EVVGVQVISLDQAPQGYGEFDAGVPKKFVIDPHKMFSAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory