SitesBLAST
Comparing PfGW456L13_2186 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2186 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
79% identity, 97% coverage: 5:337/345 of query aligns to 2:316/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), T13 (= T16), G14 (= G17), S15 (= S18), F16 (= F19), S36 (= S39), R37 (= R40), D38 (= D41), K41 (= K44), D60 (= D63), V61 (= V64), A80 (= A83), A81 (= A84), A82 (= A85), K84 (= K87), T99 (= T102), L122 (= L125), K138 (= K141), Y164 (= Y165)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
68% identity, 96% coverage: 2:333/345 of query aligns to 8:340/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G14), T22 (= T16), G23 (= G17), S24 (= S18), F25 (= F19), S45 (= S39), R46 (= R40), D47 (= D41), K50 (= K44), D69 (= D63), V70 (= V64), A89 (= A83), A90 (= A84), A91 (= A85), K93 (= K87), L131 (= L125), T133 (= T127), K147 (= K141), Y173 (= Y165)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q88), V95 (= V89), K135 (= K129), N175 (= N167), S182 (= S174), V183 (= V175), L186 (= L178), T198 (≠ S190), T200 (= T192), M204 (= M196), V240 (= V232), R263 (= R256), E266 (= E259), Y278 (≠ M271), S313 (≠ T306), Y314 (≠ E307), E315 (≠ D308), Y316 (= Y309), N320 (= N313)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
68% identity, 96% coverage: 2:333/345 of query aligns to 8:340/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K87), Q94 (= Q88), N175 (= N167), S179 (= S171), R180 (= R172), S182 (= S174), V183 (= V175), L186 (= L178), T198 (≠ S190), I199 (≠ L191), T200 (= T192), M204 (= M196), R206 (= R198), V240 (= V232), R263 (= R256), E266 (= E259)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
64% identity, 96% coverage: 3:333/345 of query aligns to 1:312/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), T14 (= T16), G15 (= G17), F17 (= F19), S37 (= S39), R38 (= R40), D39 (= D41), K42 (= K44), D61 (= D63), V62 (= V64), R63 (= R65), A81 (= A83), A82 (= A84), A83 (= A85), K85 (= K87), S124 (= S126), T125 (= T127), K139 (= K141), Y165 (= Y165), G166 (= G166)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
57% identity, 95% coverage: 5:333/345 of query aligns to 1:267/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G14), T12 (= T16), G13 (= G17), S14 (= S18), F15 (= F19), S35 (= S39), R36 (= R40), D37 (= D41), K40 (= K44), D59 (= D63), V60 (= V64), A80 (= A84), A81 (= A85), K83 (= K87), L121 (= L125), T123 (= T127), K137 (= K141), Y163 (= Y165), G164 (= G166)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
41% identity, 93% coverage: 7:326/345 of query aligns to 4:327/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), T13 (= T16), G14 (= G17), S15 (= S18), F16 (= F19), S37 (= S39), R38 (= R40), D39 (= D41), K42 (= K44), D61 (= D63), V62 (= V64), A81 (= A83), A82 (= A84), A83 (= A85), K85 (= K87), T100 (= T102), L123 (= L125), S124 (= S126), K139 (= K141), Y165 (= Y165), G166 (= G166), V168 (= V168), S171 (= S171), R172 (= R172)
- binding uridine-5'-diphosphate: K127 (= K129), N167 (= N167), V175 (= V175), P191 (= P188), I192 (≠ L191), T193 (= T192), M197 (= M196), R199 (= R198), M233 (≠ V232), R252 (= R256)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
41% identity, 93% coverage: 7:326/345 of query aligns to 10:333/333 of O25511
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
41% identity, 93% coverage: 7:326/345 of query aligns to 6:329/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K87), S176 (= S174), V177 (= V175), T195 (= T192), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R256), E257 (= E259)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (= T16), G16 (= G17), S17 (= S18), F18 (= F19), S39 (= S39), R40 (= R40), D41 (= D41), K44 (= K44), D63 (= D63), V64 (= V64), A83 (= A83), A84 (= A84), A85 (= A85), K87 (= K87), L125 (= L125), S126 (= S126), Y137 (≠ M137), K141 (= K141), Y167 (= Y165), G168 (= G166), V170 (= V168)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
41% identity, 93% coverage: 7:326/345 of query aligns to 6:329/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (= T16), G16 (= G17), S17 (= S18), F18 (= F19), R40 (= R40), D41 (= D41), K44 (= K44), D63 (= D63), V64 (= V64), A83 (= A83), A84 (= A84), A85 (= A85), K87 (= K87), L125 (= L125), S126 (= S126), K141 (= K141), Y167 (= Y165), G168 (= G166), V170 (= V168), R174 (= R172)
- binding uridine-5'-diphosphate-glucose: K87 (= K87), T127 (= T127), K129 (= K129), Y137 (≠ M137), N169 (= N167), S176 (= S174), V177 (= V175), P193 (= P188), T195 (= T192), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R256), E257 (= E259)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
41% identity, 93% coverage: 7:326/345 of query aligns to 6:329/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (= T16), G16 (= G17), S17 (= S18), F18 (= F19), R40 (= R40), D41 (= D41), K44 (= K44), D63 (= D63), V64 (= V64), A84 (= A84), A85 (= A85), K87 (= K87), S126 (= S126), Y137 (≠ M137), K141 (= K141), Y167 (= Y165), G168 (= G166), V170 (= V168), S173 (= S171), R174 (= R172)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K87), D128 (= D128), K129 (= K129), N169 (= N167), G175 (= G173), S176 (= S174), V177 (= V175), P193 (= P188), I194 (≠ L191), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R256), E257 (= E259)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
41% identity, 93% coverage: 7:326/345 of query aligns to 6:329/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (= T16), G16 (= G17), S17 (= S18), F18 (= F19), S39 (= S39), R40 (= R40), D41 (= D41), K44 (= K44), D63 (= D63), V64 (= V64), A83 (= A83), A84 (= A84), A85 (= A85), K87 (= K87), T102 (= T102), L125 (= L125), S126 (= S126), T127 (= T127), Y137 (≠ M137), K141 (= K141), Y167 (= Y165), G168 (= G166), V170 (= V168), S173 (= S171), R174 (= R172)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K87), T127 (= T127), D128 (= D128), K129 (= K129), Y137 (≠ M137), N169 (= N167), S176 (= S174), V177 (= V175), P193 (= P188), T195 (= T192), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R256), E257 (= E259)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
35% identity, 94% coverage: 5:327/345 of query aligns to 3:321/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), T14 (= T16), G15 (= G17), T16 (≠ S18), I17 (≠ F19), S37 (= S39), R38 (= R40), S39 (≠ D41), D63 (= D63), I64 (≠ V64), V83 (≠ A83), A84 (= A84), K87 (= K87), T125 (≠ L125), S127 (≠ T127), Y137 (≠ M137), K141 (= K141), F167 (≠ Y165), V170 (= V168), S173 (= S171), R174 (= R172)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K87), H88 (≠ Q88), S127 (≠ T127), N128 (≠ D128), Y137 (≠ M137), N169 (= N167), S176 (= S174), V177 (= V175), L180 (= L178), T192 (≠ S190), T194 (= T192), M198 (= M196), R200 (= R198), L234 (≠ V232), E265 (= E259)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
34% identity, 81% coverage: 5:285/345 of query aligns to 3:265/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ T16), G15 (= G17), S16 (= S18), L17 (≠ F19), R36 (= R40), D37 (= D41), D59 (= D63), I60 (≠ V64), A81 (= A83), A82 (= A84), A83 (= A85), K85 (= K87), V128 (≠ L125), Y140 (≠ M137), K144 (= K141), Y168 (= Y165), G169 (= G166), V171 (= V168)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
36% identity, 78% coverage: 1:269/345 of query aligns to 18:289/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G14), G34 (= G17), T35 (≠ S18), I36 (≠ F19), D56 (≠ S39), H57 (≠ R40), S82 (≠ Y60), I83 (= I61), A104 (= A83), A105 (= A84), A106 (= A85), K108 (= K87), N123 (≠ T102), I146 (≠ L125), K162 (= K141), F184 (≠ Y165), G185 (= G166), N186 (= N167), V187 (= V168), S190 (= S171), S191 (≠ R172)
- binding uridine-5'-diphosphate: K150 (= K129), N186 (= N167), S193 (= S174), V194 (= V175), T209 (≠ S190), L210 (= L191), T211 (= T192), I215 (≠ M196), R217 (= R198), E279 (= E259)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
36% identity, 78% coverage: 1:269/345 of query aligns to 18:289/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G14), G34 (= G17), T35 (≠ S18), I36 (≠ F19), D56 (≠ S39), H57 (≠ R40), S82 (≠ Y60), I83 (= I61), A104 (= A83), A105 (= A84), A106 (= A85), K108 (= K87), N123 (≠ T102), I146 (≠ L125), K162 (= K141), F184 (≠ Y165), G185 (= G166), N186 (= N167), V187 (= V168), S190 (= S171), S191 (≠ R172)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K87), H109 (≠ Q88), T148 (= T127), G185 (= G166), N186 (= N167), S193 (= S174), V194 (= V175), T209 (≠ S190), L210 (= L191), T211 (= T192), I215 (≠ M196), R217 (= R198), R276 (= R256), E279 (= E259)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
31% identity, 65% coverage: 6:230/345 of query aligns to 29:259/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G17), S41 (= S18), I42 (≠ F19), D62 (≠ S39), I63 (≠ R40), D92 (= D63), I93 (≠ V64), L114 (≠ A83), S115 (≠ A84), A116 (= A85), K118 (= K87), V158 (≠ L125), D161 (= D128), K174 (= K141), V198 (= V168), S201 (= S171)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 65% coverage: 6:229/345 of query aligns to 27:242/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G17), S39 (= S18), I40 (≠ F19), D60 (≠ S39), I61 (≠ R40), L89 (≠ G62), D90 (= D63), I91 (≠ V64), L112 (≠ A83), S113 (≠ A84), A114 (= A85), K116 (= K87), D159 (= D128), K172 (= K141), N195 (= N167), V196 (= V168), S199 (= S171)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
31% identity, 48% coverage: 8:171/345 of query aligns to 2:181/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (≠ S18), I13 (≠ F19), D32 (≠ S39), N33 (≠ R40), S35 (≠ E42), G37 (≠ K44), D57 (= D63), L58 (≠ V64), F79 (≠ A83), A80 (= A84), I83 (≠ K87), N98 (≠ T102), Y147 (≠ M137), K151 (= K141), Y175 (= Y165), N177 (= N167), V178 (= V168)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 70% coverage: 10:250/345 of query aligns to 3:262/309 of 4zrnA
- active site: T117 (= T127), G119 (≠ K129), A120 (= A130), Y143 (≠ M137), K147 (= K141), Y181 (vs. gap), G185 (≠ S174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (≠ S18), I12 (≠ F19), D31 (≠ F38), N32 (≠ S39), S34 (≠ D41), S35 (≠ E42), G36 (≠ K43), S51 (≠ D63), I52 (≠ V64), L73 (≠ A83), A74 (= A84), A75 (= A85), T92 (= T102), S115 (≠ L125), S116 (= S126), Y143 (≠ M137), K147 (= K141), Y170 (= Y165), V173 (= V168)
- binding uridine-5'-diphosphate-glucose: T117 (= T127), G119 (≠ K129), A120 (= A130), Y143 (≠ M137), N172 (= N167), G185 (≠ S174), V186 (= V175), H201 (≠ S190), F203 (vs. gap), Y208 (≠ M196), R210 (= R198), V244 (= V232)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
27% identity, 74% coverage: 10:265/345 of query aligns to 3:283/322 of 1r66A
- active site: T127 (= T127), D128 (= D128), E129 (≠ K129), Y151 (≠ M137), K155 (= K141)
- binding nicotinamide-adenine-dinucleotide: G10 (= G17), F11 (≠ S18), I12 (≠ F19), D37 (= D41), S38 (≠ E42), L39 (≠ K43), T40 (≠ K44), G43 (≠ D47), D63 (= D63), I64 (≠ V64), F83 (≠ A83), A84 (= A84), A85 (= A85), S87 (≠ K87), T102 (= T102), V125 (≠ L125), S126 (= S126), Y151 (≠ M137), K155 (= K141), N181 (≠ R164)
- binding thymidine-5'-diphosphate: H88 (≠ Q88), E129 (≠ K129), N180 (≠ T163), K190 (≠ S174), L191 (≠ V175), P206 (= P188), Y208 (≠ S190), R215 (≠ T197), N250 (≠ V232), R274 (= R256), H277 (≠ E259)
Query Sequence
>PfGW456L13_2186 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2186
MAISFSNSTLLITGGTGSFGNAVLKRFLDTDIKEIRVFSRDEKKQDDMRKKYANTKLKFY
IGDVRDFQSVLNATRGVDYIFHAAALKQVPSCEFHPMEAVKTNVLGTDNVLEAAIQNNVK
RVVCLSTDKAVYPINAMGISKAMMEKVMVAKSRNDNNTVICGTRYGNVMASRGSVIPLFV
DQIRSGIPLSLTDPNMTRFMMTLADAVDLVLYAFEHGTNGDMFVQKAPAATVEVLAKALI
NMLNVPDHPVQVIGTRHGEKLFEALLSREEMACAEDRGDYFRVPPDLRDLNYSKFVEQGE
TKISRTEDYNSHNTERLDVEGMQKLLLKLNFMRAIQRGEHATPEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory