SitesBLAST
Comparing PfGW456L13_2503 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2503 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
39% identity, 94% coverage: 16:273/275 of query aligns to 23:286/286 of P47229
- S112 (= S104) mutation to A: Catalyzes the tautomerisation of HOPDA. Extremely low hydrolase activity; when associated with A-265.
- H265 (= H252) mutation to A: Unable to catalyze the tautomerisation of HOPDA. Extremely low hydrolase activity; when associated with A-112.
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
39% identity, 94% coverage: 16:273/275 of query aligns to 22:285/285 of 2og1A
- active site: G41 (≠ S35), G42 (= G36), G44 (= G38), N110 (= N103), S111 (= S104), M112 (≠ L105), L155 (≠ M148), R189 (= R185), A207 (≠ T199), D236 (= D224), H264 (= H252), W265 (= W253)
- binding glycerol: Y52 (≠ K46), E184 (= E180)
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
38% identity, 94% coverage: 16:273/275 of query aligns to 20:283/283 of 2rhwA
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N108 (= N103), A109 (≠ S104), M110 (≠ L105), R187 (= R185), D234 (= D224), H262 (= H252), W263 (= W253)
- binding 3-fluoro-6-(4-fluorophenyl)-2-hydroxy-6-oxohexa-2,4-dienoic acid: G38 (= G34), G39 (≠ S35), G40 (= G36), A109 (≠ S104), M110 (≠ L105), G135 (= G130), I150 (= I145), F172 (≠ Q170), L210 (vs. gap), F236 (= F226), V237 (≠ C227), H262 (= H252)
2rhtA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda (see paper)
38% identity, 94% coverage: 16:273/275 of query aligns to 20:283/283 of 2rhtA
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N108 (= N103), A109 (≠ S104), M110 (≠ L105), R187 (= R185), D234 (= D224), H262 (= H252), W263 (= W253)
- binding (2Z,4E)-3-chloro-2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid: G38 (= G34), G39 (≠ S35), G40 (= G36), A109 (≠ S104), M110 (≠ L105), I150 (= I145), L153 (≠ M148), F172 (≠ Q170), R187 (= R185), F236 (= F226), V237 (≠ C227), H262 (= H252)
2puhA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
38% identity, 94% coverage: 16:273/275 of query aligns to 20:283/283 of 2puhA
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N108 (= N103), A109 (≠ S104), M110 (≠ L105), R187 (= R185), D234 (= D224), H262 (= H252), W263 (= W253)
- binding (3e)-2,6-dioxo-6-phenylhex-3-enoate: G38 (= G34), G39 (≠ S35), G40 (= G36), N108 (= N103), A109 (≠ S104), M110 (≠ L105), I150 (= I145), F172 (≠ Q170), R187 (= R185), L210 (vs. gap), W213 (vs. gap), V237 (≠ C227), H262 (= H252), W263 (= W253)
2pujA Crystal structure of the s112a/h265a double mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
38% identity, 94% coverage: 16:273/275 of query aligns to 20:283/283 of 2pujA
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N108 (= N103), A109 (≠ S104), M110 (≠ L105), R187 (= R185), D234 (= D224), A262 (≠ H252), W263 (= W253)
- binding (2e,4e)-2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid: G38 (= G34), G39 (≠ S35), G40 (= G36), A109 (≠ S104), M110 (≠ L105), G135 (= G130), I150 (= I145), L153 (≠ M148), F172 (≠ Q170), R187 (= R185), V237 (≠ C227)
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 94% coverage: 16:274/275 of query aligns to 24:291/291 of P9WNH5
- S114 (= S104) mutation to A: Reduces the hydrolase activity.
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/284 of 7zm4A
7zm3A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc17 (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/284 of 7zm3A
7zm2A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc8b (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/284 of 7zm2A
7zm1A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc7b (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/284 of 7zm1A
5jzsB Hsad bound to 3,5-dichloro-4-hydroxybenzoic acid (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/284 of 5jzsB
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N107 (= N103), S108 (= S104), L109 (= L105), R186 (= R185), D235 (= D224), H263 (= H252), W264 (= W253)
- binding 3,5-dichloro-4-hydroxybenzoic acid: G39 (≠ S35), S108 (= S104), G148 (= G144), V149 (≠ I145), L152 (≠ M148), V237 (≠ F226)
5jz9A Crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/284 of 5jz9A
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N107 (= N103), S108 (= S104), L109 (= L105), R186 (= R185), D235 (= D224), H263 (= H252), W264 (= W253)
- binding 3,5-dichloro-4-hydroxybenzene-1-sulfonic acid: G38 (= G34), G39 (≠ S35), G40 (= G36), S108 (= S104), G148 (= G144), L152 (≠ M148), F167 (≠ L166), M171 (≠ Q170), V237 (≠ F226), H263 (= H252), W264 (= W253)
5jzbA Crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/282 of 5jzbA
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N107 (= N103), S108 (= S104), L109 (= L105), R186 (= R185), D235 (= D224), H263 (= H252), W264 (= W253)
- binding 3,5-dichlorobenzene-1-sulfonamide: G39 (≠ S35), G40 (= G36), S108 (= S104), L109 (= L105), G134 (= G130), L152 (≠ M148), N238 (≠ C227)
2wugA Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopda (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/283 of 2wugA
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N107 (= N103), A108 (≠ S104), L109 (= L105), R186 (= R185), D235 (= D224), H263 (= H252), W264 (= W253)
- binding (3e)-2,6-dioxo-6-phenylhex-3-enoate: G38 (= G34), G39 (≠ S35), G40 (= G36), A108 (≠ S104), L109 (= L105), M202 (vs. gap), H263 (= H252), W264 (= W253)
2wufB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with 4,9dsha (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/282 of 2wufB
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N107 (= N103), A108 (≠ S104), L109 (= L105), R186 (= R185), D235 (= D224), H263 (= H252), W264 (= W253)
- binding (3e,5r)-8-[(1s,3ar,4r,7as)-1-hydroxy-7a-methyl-5-oxooctahydro-1h-inden-4-yl]-5-methyl-2,6-dioxooct-3-enoate: G38 (= G34), G39 (≠ S35), G40 (= G36), A108 (≠ S104), L109 (= L105), L152 (≠ M148), F206 (vs. gap), H263 (= H252), W264 (= W253)
2wueB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopoda (see paper)
34% identity, 93% coverage: 16:270/275 of query aligns to 18:281/282 of 2wueB
- active site: G39 (≠ S35), G40 (= G36), G42 (= G38), N107 (= N103), A108 (≠ S104), L109 (= L105), R186 (= R185), D235 (= D224), H263 (= H252), W264 (= W253)
- binding (3e,5r)-8-(2-chlorophenyl)-5-methyl-2,6-dioxooct-3-enoate: G38 (= G34), G39 (≠ S35), G40 (= G36), A108 (≠ S104), L109 (= L105), V149 (≠ I145), L152 (≠ M148), M202 (vs. gap), F206 (vs. gap), V237 (≠ F226), H263 (= H252)
P77044 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase; 2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid 5,6-hydrolase; 2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid 5,6-hydrolase; 2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid 5,6-hydrolase; EC 3.7.1.14 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 93% coverage: 16:270/275 of query aligns to 24:285/288 of P77044
- S44 (= S35) mutation to A: 2-fold decrease in catalytic efficiency and more than 5-fold increase in affinity for the natural substrate.
- N113 (= N103) mutation to A: 200-fold decrease in catalytic activity and almost 2-fold increase in affinity.; mutation to H: 350-fold decrease in catalytic activity and almost 2-fold increase in affinity.
- S114 (= S104) Transition state stabilizer; mutation to A: Weakly active. 3-fold decrease in affinity. Fast ketonisation and slow C-C cleavage.; mutation to G: Weakly active. 3-fold decrease in affinity. Fast ketonisation and slow C-C cleavage.
- H118 (≠ A108) mutation to A: More than 2-fold decrease in catalytic efficiency and 3-fold increase affinity.
- F177 (≠ Q170) mutation to D: 100-fold decrease in catalytic activity.; mutation to G: 4-fold and 8-fold decrease in catalytic activity and affinity, respectively.
- R192 (= R185) Catalytic role in ketonization of the dienol substrate (substrate destabilization); mutation to K: 40-fold and 5-fold decrease in catalytic activity and affinity, respectively.; mutation to Q: 280-fold and 10-fold decrease in catalytic activity and affinity, respectively.
- C265 (= C250) mutation to A: 2-fold decrease in catalytic activity and almost 2-fold increase in affinity.
- H267 (= H252) active site, Proton acceptor; mutation to A: Weakly active, 1000-fold decrease in catalytic efficiency. Very slow ketonisation and C-C cleavage.
- W268 (= W253) mutation to G: 10-fold and 20-fold decrease in catalytic activity and affinity, respectively.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
32% identity, 95% coverage: 12:273/275 of query aligns to 9:271/271 of 1ukaA
- active site: S32 (= S35), G33 (= G36), G35 (= G38), N100 (= N103), A101 (≠ S104), F102 (≠ L105), G125 (≠ A128), V140 (≠ A151), R172 (= R185), F185 (≠ S198), D222 (= D224), H250 (= H252), W251 (= W253)
- binding 2-methylbutanoic acid: S32 (= S35), A101 (≠ S104), F102 (≠ L105), W141 (≠ F152), V224 (≠ F226), H250 (= H252)
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
32% identity, 95% coverage: 12:273/275 of query aligns to 9:271/271 of 1uk9A
- active site: S32 (= S35), G33 (= G36), G35 (= G38), N100 (= N103), A101 (≠ S104), F102 (≠ L105), G125 (≠ A128), V140 (≠ A151), R172 (= R185), F185 (≠ S198), D222 (= D224), H250 (= H252), W251 (= W253)
- binding isovaleric acid: S32 (= S35), A101 (≠ S104), F102 (≠ L105), W141 (≠ F152), H250 (= H252)
Query Sequence
>PfGW456L13_2503 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2503
MGASAQGHFVTLPDGLQLHYKDTGNGEPVIFIHGSGPGASGHSNFKQNYPLFTEAGYRVI
VPDLPGYGASDKPDTLYTLDFFVAALSGLLDALDIQRCVLVGNSLGGAIAIKLALDQPQR
ISRLVLMAPGGLMEKEQYYLQMEGIQKMGAAFAKGELNDAAGMRRLLALQLFDETLISDE
TVNERVAVVKQQPVCVLSTMQVPNMTSRLGELQCPILGFWGMNDKFCPSSGAQTMLEHCT
QIRFVMLSECGHWVQVEHRDFFNRQCLAFFQEARG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory