Comparing PfGW456L13_2530 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zi8A Crystal structure of the hsac extradiol dioxygenase from m. Tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3, 5(10)-triene-9,17-dione (dhsa) (see paper)
44% identity, 99% coverage: 1:296/298 of query aligns to 1:297/299 of 2zi8A
P9WNW7 Iron-dependent extradiol dioxygenase; EC 1.13.11.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 99% coverage: 1:296/298 of query aligns to 1:297/300 of P9WNW7
1lkdA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2',6'-dicl dihydroxybiphenyl (dhb) (see paper)
43% identity, 97% coverage: 3:291/298 of query aligns to 2:284/287 of 1lkdA
1lgtA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2'-cl dihydroxybiphenyl (dhb) (see paper)
43% identity, 97% coverage: 3:291/298 of query aligns to 2:284/287 of 1lgtA
1hanA Crystal structure of the biphenyl-cleaving extradiol dioxygenase from a pcb-degrading pseudomonad (see paper)
43% identity, 97% coverage: 3:291/298 of query aligns to 2:284/287 of 1hanA
Sites not aligning to the query:
1knfA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 3-methyl catechol under anaerobic condition (see paper)
43% identity, 97% coverage: 3:291/298 of query aligns to 2:284/288 of 1knfA
1kndA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with catechol under anaerobic condition (see paper)
43% identity, 97% coverage: 3:291/298 of query aligns to 2:284/288 of 1kndA
1kmyA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 2,3-dihydroxybiphenyl under anaerobic condition (see paper)
43% identity, 97% coverage: 3:291/298 of query aligns to 2:284/288 of 1kmyA
1eirA 2,3-dihydroxybiphenyl-1,2-dioxygenase (see paper)
40% identity, 97% coverage: 3:291/298 of query aligns to 2:285/289 of 1eirA
1eilA 2,3-dihydroxybiphenyl-1,2-dioxygenase (see paper)
40% identity, 97% coverage: 3:291/298 of query aligns to 2:285/289 of 1eilA
1kw8B Crystal structure of bphc-2,3-dihydroxybiphenyl-no complex (see paper)
40% identity, 97% coverage: 3:291/298 of query aligns to 2:285/288 of 1kw8B
1kw3B Crystal structure of 2,3-dihydroxybiphenyal dioxygenase (bphc) at 1.45 a resolution (see paper)
40% identity, 97% coverage: 3:291/298 of query aligns to 2:285/288 of 1kw3B
6l3wA Crystal structure of bphc, a halotolerant catechol dioxygenase (see paper)
37% identity, 97% coverage: 3:291/298 of query aligns to 4:283/298 of 6l3wA
2wl9A Crystal structure of catechol 2,3-dioxygenase (see paper)
34% identity, 88% coverage: 6:267/298 of query aligns to 7:265/300 of 2wl9A
2wl3A Crystal structure of catechol 2,3-dioxygenase (see paper)
34% identity, 88% coverage: 6:267/298 of query aligns to 6:264/287 of 2wl3A
2wl9B Crystal structure of catechol 2,3-dioxygenase (see paper)
34% identity, 88% coverage: 6:267/298 of query aligns to 6:259/293 of 2wl9B
2ei3A Anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygenase from pseudomonas sp. Strain c18 complexes with 2,3- dihydroxybiphenyl
32% identity, 89% coverage: 6:270/298 of query aligns to 6:267/298 of 2ei3A
Sites not aligning to the query:
2ehzA Anaerobic crystal structure analysis of 1,2-dihydroxynaphthalene dioxygenase from pseudomonas sp. Strain c18 complexed with 4- methylcatechol
32% identity, 89% coverage: 6:270/298 of query aligns to 7:268/299 of 2ehzA
Sites not aligning to the query:
2ei1A Anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygeanse of pseudomonas sp. Strain c18 complexes to 1,2- dihydroxynaphthalene
32% identity, 89% coverage: 6:270/298 of query aligns to 6:262/293 of 2ei1A
2ei0A Anaerobic crystal structure analysis of 1,2-dihydroxynaphthalene dioxygenase from pseudomonas sp. Strain c18 complexed with 3,4- dihydroxybiphenyl
32% identity, 89% coverage: 6:270/298 of query aligns to 6:262/286 of 2ei0A
Sites not aligning to the query:
>PfGW456L13_2530 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2530
MDIRGLGYVTLLSSDLAQWRHYASQVLGMMVIGSDDDAHLYLKMDERHYRILVQKNVENG
FGACGWEVAGKAALEQAVSELQQADVQVTRGTAAEAELRKVQELVHFSDPDGNRHEIFWG
PLQDFARFVSPVGVKGFVTNELGMGHVVLPAPAFERCRDFYEQVLGFGLSDLMKVRFTPD
PAEPQKRIHFLHCNNGRHHSLAIFECPMPHGCVHMMVEVNALDEVGRALDRVHANGVKLS
ATLGQHTNDQMISFYIKTPSGFDLEYGCDGLVVDWDRHTPFESTVVSHWGHDFSVGRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory