SitesBLAST
Comparing PfGW456L13_2810 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
33% identity, 80% coverage: 3:265/327 of query aligns to 1:261/333 of 4koaA
- active site: K94 (= K97), H180 (= H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), A9 (≠ C11), S10 (≠ G12), T11 (≠ S13), I12 (≠ V14), S33 (≠ G36), S34 (≠ R37), R38 (≠ A41), T71 (= T74), N73 (≠ P76), H76 (= H79), K94 (= K97), Q160 (≠ D167)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
31% identity, 80% coverage: 5:265/327 of query aligns to 2:260/332 of 2glxA
- active site: K93 (= K97), H179 (= H187)
- binding acetate ion: K93 (= K97), H179 (= H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), A8 (≠ C11), S9 (≠ G12), T10 (≠ S13), I11 (≠ V14), S32 (≠ G36), T33 (≠ R37), R37 (≠ A41), S69 (≠ A73), T70 (= T74), N72 (≠ P76), H75 (= H79), E92 (= E96), K93 (= K97), H121 (≠ Y125), W161 (= W169), R162 (= R170)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
31% identity, 80% coverage: 5:265/327 of query aligns to 3:261/333 of Q2I8V6
- ASTI 9:12 (≠ CGSV 11:14) binding
- S10 (≠ G12) mutation to G: Almost no effect.
- A13 (= A15) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ G36) mutation to D: No activity.
- ST 33:34 (≠ GR 36:37) binding
- R38 (≠ A41) binding
- TTNELH 71:76 (≠ TPPDSH 74:79) binding
- EK 93:94 (= EK 96:97) binding
- K94 (= K97) mutation to G: Less than 1% remaining activity.
- N120 (≠ S123) binding
- WR 162:163 (= WR 169:170) binding
- D176 (= D183) mutation to A: Less than 1% remaining activity.
- H180 (= H187) mutation to A: Less than 2% remaining activity.
- G206 (vs. gap) mutation to I: No effect.
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
29% identity, 77% coverage: 7:258/327 of query aligns to 6:273/372 of 6a3iA
- binding Levoglucosan: K103 (= K97), Y132 (≠ R126), Y160 (≠ L154), Q162 (≠ K156), R175 (= R170), D188 (= D183), H192 (= H187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (vs. gap), M13 (vs. gap), E42 (≠ R37), A43 (vs. gap), P81 (= P75), N82 (≠ P76), L84 (≠ S78), H85 (= H79), E102 (= E96), K103 (= K97), W174 (= W169), R175 (= R170)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
29% identity, 72% coverage: 23:258/327 of query aligns to 27:277/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: E41 (≠ R37), T79 (= T74), P80 (= P75), N81 (≠ P76), H84 (= H79), E101 (= E96), K102 (= K97), W173 (= W169), R174 (= R170)
- binding alpha-L-sorbopyranose: K102 (= K97), Y131 (≠ R126), Y159 (≠ L154), Q161 (≠ K156), W163 (≠ P158), R174 (= R170), D187 (= D183)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
29% identity, 77% coverage: 4:255/327 of query aligns to 8:258/347 of 3q2kC
- active site: K100 (= K97), H188 (= H187)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ S13), K100 (= K97), W159 (= W152), T160 (= T153), R161 (≠ L154), Y165 (≠ P158), N184 (≠ D183), Q185 (≠ L184), H188 (= H187), Q243 (≠ D240), N244 (≠ R241)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G12), R17 (≠ S13), I18 (≠ V14), D40 (≠ G36), T41 (≠ R37), A76 (= A73), T77 (= T74), S79 (≠ P76), H82 (= H79), Q85 (≠ Y82), E99 (= E96), K100 (= K97), Q128 (≠ Y125), W171 (≠ G165), R172 (≠ T166)
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
29% identity, 77% coverage: 4:255/327 of query aligns to 3:253/322 of 3q2kK
- active site: K95 (= K97), H183 (= H187)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ S13), K95 (= K97), T155 (= T153), R156 (≠ L154), Y160 (≠ P158), N179 (≠ D183), Q180 (≠ L184), H183 (= H187), N239 (≠ R241)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G11 (= G12), R12 (≠ S13), I13 (≠ V14), D35 (≠ G36), T36 (≠ R37), T72 (= T74), P73 (= P75), S74 (≠ P76), L76 (≠ S78), H77 (= H79), E94 (= E96), K95 (= K97), Q123 (≠ Y125), W166 (≠ S164), R167 (≠ T166), H183 (= H187)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
28% identity, 79% coverage: 1:258/327 of query aligns to 1:289/390 of F0M433
- F13 (≠ S13) binding
- M14 (≠ V14) binding
- E43 (≠ R37) binding
- T81 (= T74) binding
- N83 (≠ P76) binding
- H86 (= H79) binding
- E103 (= E96) binding
- K104 (= K97) binding ; binding
- A130 (≠ S123) binding
- N132 (≠ Y125) binding
- Y133 (≠ R126) binding
- Q163 (≠ K156) binding
- W175 (= W169) binding
- R176 (= R170) binding ; binding
- D189 (= D183) binding
- H193 (= H187) binding
Sites not aligning to the query:
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
28% identity, 78% coverage: 2:255/327 of query aligns to 1:246/325 of 3rc1A
- active site: K95 (= K97), Y179 (≠ H187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (= C11), A11 (≠ G12), D12 (≠ S13), I13 (≠ V14), S35 (≠ G36), R36 (= R37), Y56 (≠ A58), P71 (≠ A73), L72 (≠ T74), P73 (= P75), H77 (= H79), E94 (= E96), K95 (= K97), I162 (≠ D167), R163 (≠ N168), V168 (≠ A176), D175 (= D183), Y179 (≠ H187)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (= R17), R17 (≠ K18), F152 (≠ L154), I154 (≠ K156), P155 (≠ A157), Y233 (≠ V238)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
28% identity, 78% coverage: 2:255/327 of query aligns to 8:253/332 of B3TMR8
- 17:23 (vs. 11:17, 43% identical) binding
- SR 42:43 (≠ GR 36:37) binding
- Y63 (≠ A58) binding
- L79 (≠ T74) binding
- H84 (= H79) binding
- K102 (= K97) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (≠ N168) binding
- D182 (= D183) binding
- Y186 (≠ H187) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
29% identity, 59% coverage: 4:197/327 of query aligns to 3:190/334 of Q7JK39
- H79 (= H79) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (≠ H187) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
29% identity, 59% coverage: 4:197/327 of query aligns to 3:190/334 of Q9TQS6
- R148 (= R148) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
Sites not aligning to the query:
- 202 R→A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
29% identity, 59% coverage: 4:197/327 of query aligns to 2:189/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
29% identity, 59% coverage: 4:197/327 of query aligns to 2:189/331 of 2o4uX
- binding phosphate ion: L2 (≠ V4), S8 (≠ G10), V9 (≠ C11), A35 (≠ G36), R36 (= R37), R40 (≠ A41), Y57 (≠ A58), N101 (= N102), A103 (≠ G104), D145 (≠ E146), R147 (= R148), K155 (≠ W152)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
21% identity, 78% coverage: 4:258/327 of query aligns to 4:257/325 of 1zh8A
- active site: K98 (= K97), H187 (= H187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), C11 (= C11), G12 (= G12), I13 (≠ S13), A14 (≠ V14), S37 (≠ G36), R38 (= R37), T39 (≠ R38), H42 (≠ A41), T74 (≠ A73), L75 (≠ T74), P76 (= P75), L79 (≠ S78), E97 (= E96), K98 (= K97), N126 (≠ Y125), Y165 (≠ S164), W170 (= W169), R171 (= R170), H187 (= H187)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
27% identity, 70% coverage: 6:233/327 of query aligns to 5:238/340 of 1evjA
- active site: K100 (= K97), Y188 (≠ H187)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), L10 (≠ C11), G11 (= G12), K12 (≠ S13), Y13 (≠ V14), D35 (≠ G36), L77 (≠ T74), P78 (= P75), N79 (≠ P76), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W170 (= W169), R171 (= R170), Y188 (≠ H187)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
27% identity, 76% coverage: 6:253/327 of query aligns to 5:253/335 of 5a05A
- active site: K100 (= K97), Y185 (≠ H187)
- binding beta-D-glucopyranose: K100 (= K97), F159 (≠ W152), D181 (= D183), Y185 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ C11), G11 (= G12), Y12 (≠ S13), Y13 (≠ V14), S35 (≠ G36), G36 (≠ R37), T37 (≠ R38), K40 (≠ A41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), N79 (≠ P76), L81 (≠ S78), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W169), R168 (= R170), Y185 (≠ H187)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
27% identity, 76% coverage: 6:253/327 of query aligns to 5:253/335 of 5a04A
- active site: K100 (= K97), Y185 (≠ H187)
- binding beta-D-glucopyranose: K100 (= K97), F159 (≠ W152), R168 (= R170), D181 (= D183), Y185 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ C11), G11 (= G12), Y12 (≠ S13), Y13 (≠ V14), S35 (≠ G36), G36 (≠ R37), T37 (≠ R38), K40 (≠ A41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), N79 (≠ P76), L81 (≠ S78), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W169), R168 (= R170), Y185 (≠ H187)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 76% coverage: 6:253/327 of query aligns to 5:253/335 of 5a03E
- active site: K100 (= K97), Y185 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ C11), G11 (= G12), Y12 (≠ S13), Y13 (≠ V14), S35 (≠ G36), G36 (≠ R37), T37 (≠ R38), K40 (≠ A41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), N79 (≠ P76), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W169), R168 (= R170), Y185 (≠ H187)
- binding beta-D-xylopyranose: K100 (= K97), F159 (≠ W152), R168 (= R170), D181 (= D183), Y185 (≠ H187), E205 (≠ G204), T207 (= T206), R209 (= R208)
- binding alpha-D-xylopyranose: H134 (≠ R131)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
27% identity, 76% coverage: 6:253/327 of query aligns to 5:253/335 of 5a02A
- active site: K100 (= K97), Y185 (≠ H187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ C11), G11 (= G12), Y12 (≠ S13), Y13 (≠ V14), S35 (≠ G36), G36 (≠ R37), T37 (≠ R38), K40 (≠ A41), Y58 (= Y55), I76 (≠ A73), T77 (= T74), P78 (= P75), L81 (≠ S78), H82 (= H79), E99 (= E96), K100 (= K97), R128 (≠ Y125), W167 (= W169), R168 (= R170), Y185 (≠ H187)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_2810 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2810
MNLVRWGMIGCGSVAERKSGPAFYKAPGSALVAVMGRRLEAVTDYATRHGIARVYTDAQA
LINDPEVDAVYIATPPDSHHAYALQVAAAGKHCCVEKPMALNAGQSREMQQVFADAGLHL
FVSYYRRSLPRFRQVRQWLEEGRIGEVRHLSWTLTKAPSAADRSGTDNWRTDPAIAGGGY
FADLASHGLDLFQYLFGDIVEVAGLTARQAGLYAAEDAVSATWRFASGALGMGCWNFVAD
RREDRVEVIGSKGRITFSVFDEHPVELHADELHAGEHLSLTIEHHAHIQWHHVLGMNAHI
RGETQHPAVAEQALKTDWVMDQILKRH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory