SitesBLAST
Comparing PfGW456L13_3525 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
35% identity, 89% coverage: 6:222/243 of query aligns to 7:224/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y13), F17 (≠ R16), N39 (= N38), G40 (= G39), G42 (= G41), K43 (= K42), T44 (≠ S43), T45 (= T44), T135 (≠ E134), F136 (≠ L135), S137 (≠ N136)
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 41:266/278 of 3nhaA
3nh9A Nucleotide binding domain of human abcb6 (atp bound structure) (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 35:261/273 of 3nh9A
7dnyB Cryo-em structure of the human abcb6 (coproporphyrin iii-bound) (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 337:563/575 of 7dnyB
Sites not aligning to the query:
- binding coproporphyrin III: 293, 297
- binding cholesterol hemisuccinate: 19, 23, 24, 31, 34, 51, 54, 58, 151, 155
8k7bA Post-occluded structure of human abcb6 w546a mutant (adp/vo4-bound) (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 353:579/590 of 8k7bA
- binding adp orthovanadate: Y362 (= Y13), G389 (= G39), G391 (= G41), K392 (= K42), S393 (= S43), T394 (= T44), K489 (vs. gap), L490 (= L135), S491 (≠ N136), G492 (= G137), H546 (= H193)
- binding magnesium ion: S393 (= S43), Q434 (= Q83)
Q9NP58 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; Mitochondrial ABC transporter 3; Mt-ABC transporter 3; P-glycoprotein-related protein; Ubiquitously-expressed mammalian ABC half transporter; EC 7.6.2.5 from Homo sapiens (Human) (see 11 papers)
34% identity, 92% coverage: 4:227/243 of query aligns to 590:816/842 of Q9NP58
- Y599 (= Y13) binding
- 623:634 (vs. 36:47, 67% identical) binding
- K629 (= K42) mutation to A: Abolishes ATP hydrolysis. Abolishes coproporphyrin III transport.; mutation to M: Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins. Fails to rescue vacuolar sequestration of cadmium in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Fails to rescue the cadmium tolerance in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Does not rescue vacuolar cadmium levels in hmt-1 mutant S.pombe.
- N677 (≠ L89) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498; and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498; and Q-775.
- A681 (≠ E94) to T: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs142421126
- N775 (≠ D183) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498 and Q-677. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498 and Q-677.
- L811 (= L221) to V: in MCOPCB7; hypomorphic mutation; dbSNP:rs387906910
Sites not aligning to the query:
- 1:205 Required for the lysosomal targeting
- 1:236 Required for ATPase activity
- 6 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Loss of N-glycosylation; when associated with Q-447; Q-498; Q-677 and Q-775. Does not affect substrate binding.
- 8 modified: Disulfide link with 26; C→G: Loss of N-glycosylation.; C→S: Does not affect substrate binding. Does not affect N-glycosylation. Impairs endoplasmic reticulum exit. Impairs endoplasmic reticulum exit; when associated with C-8. Increases ABCB6 proteasomal degradation. Affects protein stability. Does not affect migration in the presence of DTT; when associated with A-50 and A-120.
- 26 modified: Disulfide link with 8; C→A: Decreases protein expression. Affects protein stability. Loss of ability to stimulate porphyrin synthesis.; C→S: Decreases protein expression. Impairs endoplasmic reticulum exit; when associated with C-8. Affects protein stability.
- 50 C→A: Increases migration in the absence of DTT; when associated with A-120. Reduces migration in with the presence of DTT; when associated with A-120.
- 57 A → T: in MCOPCB7; uncertain significance; hypomorphic mutation; dbSNP:rs387906911
- 69 R → G: in a breast cancer sample; somatic mutation
- 120 C→A: Increases migration in the absence of DTT; when associated with A-50. Reduces migration in with the presence of DTT; when associated with A-50.
- 170 S → G: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514757
- 192 R → Q: decrease expression; does not affect substrate binding; does not affect ATP-binding; loss of plasma membrane expression; dbSNP:rs150221689
- 276 R → W: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs57467915
- 286 Y→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- 356 L → P: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514756
- 447 N→Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-498; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-498; Q-677 and Q-775.
- 492 A → T: may be a modifier of disease severity in porphyria patients; increases expression; does not affect substrate binding; impairs ATP-binding; Loss of ATP-dependent coproporphyrin III transport; Highly decrease plasma membrane expression; dbSNP:rs147445258
- 498 N→Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-677 and Q-775.
- 521 T → S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs149363094
- 531 V→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- 542 M→A: Loss of substrate-stimulate ATPase activity.
- 546 W→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.; W→F: Does not affect substrate-stimulate ATPase activity.; W→V: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- 579 G → E: in DUH3; the protein is retained in the Golgi apparatus. Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins.; dbSNP:rs397514758
- 588 G → S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs145526996
7dnzB Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 355:581/591 of 7dnzB
Sites not aligning to the query:
- binding glutathione: 111, 135, 139, 204, 310, 314, 317
- binding protoporphyrin ix containing fe: 85, 311
- binding cholesterol hemisuccinate: 37, 42, 177, 181, 184, 280
7dnzA Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 355:581/591 of 7dnzA
Sites not aligning to the query:
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
33% identity, 92% coverage: 4:227/243 of query aligns to 590:816/842 of Q9DC29
Sites not aligning to the query:
- 170 S→G: Results in retention of the protein in the Golgi apparatus.
- 356 L→P: Results in retention of the protein in the Golgi apparatus.
- 579 G→E: Results in retention of the protein in the Golgi apparatus.
7eklA Mitochondrial outer membrane protein (see paper)
34% identity, 92% coverage: 4:227/243 of query aligns to 353:579/590 of 7eklA
- binding adenosine-5'-triphosphate: Y362 (= Y13), R366 (= R16), G389 (= G39), A390 (= A40), G391 (= G41), K392 (= K42), S393 (= S43), F475 (≠ L124), K489 (vs. gap), L490 (= L135), S491 (≠ N136), E494 (≠ H139), H546 (= H193)
- binding magnesium ion: S393 (= S43), Q434 (= Q83)
Q0WML0 ABC transporter B family member 27; ABC transporter ABCB.27; AtABCB27; Aluminum tolerance-related ATP-binding cassette transporter; Antigen peptide transporter-like 2; Transporter associated with antigen processing-like protein 2; AtTAP2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 90% coverage: 4:221/243 of query aligns to 396:620/644 of Q0WML0
Sites not aligning to the query:
- 261 E→K: In als1-1; loss of aluminum tolerance.
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
36% identity, 93% coverage: 2:227/243 of query aligns to 652:879/908 of G7CBF5
Sites not aligning to the query:
- 70:73 binding
- 87:91 binding
- 97:98 binding
- 241:243 binding
4f4cA The crystal structure of the multi-drug transporter (see paper)
33% identity, 88% coverage: 11:224/243 of query aligns to 1028:1249/1250 of 4f4cA
Sites not aligning to the query:
7zoaB Cryo-em structure of cgt abc transporter in presence of cbg substrate (see paper)
35% identity, 88% coverage: 14:227/243 of query aligns to 346:561/570 of 7zoaB
Sites not aligning to the query:
1mv5B Crystal structure of lmra atp-binding domain
32% identity, 88% coverage: 11:225/243 of query aligns to 9:228/242 of 1mv5B
1mv5A Crystal structure of lmra atp-binding domain
32% identity, 88% coverage: 11:225/243 of query aligns to 9:228/242 of 1mv5A
7znuA Cryo-em structure of cgt abc transporter in detergent micelle (see paper)
34% identity, 86% coverage: 14:221/243 of query aligns to 346:556/556 of 7znuA
Sites not aligning to the query:
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
32% identity, 84% coverage: 13:216/243 of query aligns to 1355:1559/2595 of E9Q876
- 1388:1461 (vs. 46:118, 23% identical) mutation to M: In a mouse model for harlequin ichthyosis (HI), smooth skin (smsk) mutant mice show a pronounced perinatal lethal skin phenotype in 25% of the offspring and newborn mutant pups die within a few hours after birth, and appear severely dehydrated with dry cracking skin. Smsk homozygous mutants embryos show a normal appearance at 14.5 dpc, but at 16.5 dpc develop a partial absence of normal skin folds around the trunk and limbs, and by 18.5 dpc develop a taut, thick skin and limb contractures.
Sites not aligning to the query:
- 1996 G→D: In a mouse model for harlequin ichthyosis (HI), homozygous mice are embryonic lethal but occasionally pups are found in the first few hours after birth but die and are severely dehydrated and fail to suckle normally. Homozygous pups show hallmarks of HI desease including hyperkeratosis, abnormal extracellular lipid lamellae and defects in cornified envelope processing. At 14.5 dpc and 15.5 dpc homozygous embryos appear normal; however from 16.5 dpc onwards they are characterized by an absence of normal skin folds around the trunk and limbs. As development progressed, embryos develop a taut, thick epidermis and multiple contractures affecting the limbs. Late stage embryos are smaller.
8f5bA Human abca4 structure in complex with amp-pnp
30% identity, 83% coverage: 16:216/243 of query aligns to 735:934/1924 of 8f5bA
Sites not aligning to the query:
P9WQJ9 Mycobactin import ATP-binding/permease protein IrtA; Iron-regulated transporter A; EC 7.2.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 86% coverage: 19:227/243 of query aligns to 626:835/859 of P9WQJ9
Sites not aligning to the query:
- 70 R→A: No change in FAD-binding and in activity.
- 72 Y→A: Decrease in FAD-binding and loss of activity.
- 73 T→A: Decrease in FAD-binding and loss of activity.
Query Sequence
>PfGW456L13_3525 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3525
MNALEVSDLGFAYGSREALRKVSFSLEPGRFAALLGPNGAGKSTLIALLTRLYDLQHGEI
RVGGCSLRSAARPALRQLGVVFQQSTLDLDLSVEQNLRYHAALHGLSRRQTDLRVDVELA
RQALTDRRRERVRELNGGHRRRVEIARALLHEPRLLLLDEASAGLDPASRLALNQHIRSL
CRDEHISVLWTTHLLDEVQPSDDLLILHQGRLVASGQADTLSLEHGGDLGSAFTRLTTSG
VVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory