Comparing PfGW456L13_3735 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
24% identity, 88% coverage: 25:308/321 of query aligns to 1:285/300 of 2dvzA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
25% identity, 66% coverage: 31:243/321 of query aligns to 5:215/302 of 8hkbA
Sites not aligning to the query:
7ndsA Crystal structure of tphc in a closed conformation (see paper)
25% identity, 68% coverage: 31:247/321 of query aligns to 5:219/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
25% identity, 68% coverage: 31:247/321 of query aligns to 5:219/293 of 7ndrD
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
26% identity, 68% coverage: 40:256/321 of query aligns to 15:231/296 of 6hkeB
Sites not aligning to the query:
2f5xB Structure of periplasmic binding protein bugd (see paper)
26% identity, 70% coverage: 31:256/321 of query aligns to 7:231/300 of 2f5xB
5okuA R. Palustris rpa4515 with adipate (see paper)
22% identity, 66% coverage: 31:243/321 of query aligns to 7:218/299 of 5okuA
Sites not aligning to the query:
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
22% identity, 66% coverage: 31:243/321 of query aligns to 7:218/299 of 5oeiA
Sites not aligning to the query:
>PfGW456L13_3735 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3735
MSALIRRFSRCMAAGLTAAVLVAPAFALDTVKFMAPGSVGGGYDQTARVLGKAMVEANTA
KSATFENKGGAGGTLGLAQFANSTKGDPNALLVVGAIMVAGIEQNKPQISLKDVTPIARL
FTEYNVIAVRKDSPYKTLDDLIKDFKEKPTGVTFGGGSKGSIDHIGIAELAGKLDVPVNK
VNYIATGGGGEIVAQTLGGQIKVLTGGYAELGQYIKNGQIRVLAIGAPERVPGIDAPTLK
ESGYDVIIGNWRGVYGAANLTAEQRKEVTDAVVTASKSKVWQDNIKTNAWTESVLTGDDF
GKFVDEEHVRLRAMLVKVGLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory