SitesBLAST
Comparing PfGW456L13_4782 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4782 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 2:432/441 of query aligns to 16:449/461 of P76037
- Y110 (= Y96) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
29% identity, 76% coverage: 31:366/441 of query aligns to 50:392/458 of 6f34A
- binding arginine: E115 (≠ D95), Y116 (= Y96), A119 (≠ L99), F228 (≠ Y201), A229 (≠ S202), I231 (≠ L204), V314 (≠ S288)
- binding cholesterol: W201 (≠ H166), Y202 (= Y167)
- binding : A178 (≠ N143), R179 (≠ G144), A186 (≠ L151), I187 (≠ V152), A190 (≠ L155), L194 (≠ A159), Q296 (≠ G270), V299 (≠ F273)
Sites not aligning to the query:
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
29% identity, 76% coverage: 31:366/441 of query aligns to 48:390/456 of 5oqtA
Sites not aligning to the query:
P24207 Phenylalanine-specific permease; Phenylalanine:H(+) symporter PheP from Escherichia coli (strain K12) (see 3 papers)
27% identity, 68% coverage: 45:342/441 of query aligns to 60:359/458 of P24207
- F87 (≠ A72) mutation to L: No effect on phenylalanine transport activity.
- F90 (≠ Y75) mutation to L: 65% of wild-type phenylalanine transport activity.
- Y92 (≠ R77) mutation to L: 41% of wild-type phenylalanine transport activity.
- Y94 (≠ A79) mutation to L: 69% of wild-type phenylalanine transport activity.
- W95 (≠ I80) mutation to L: 10% of wild-type phenylalanine transport activity.
- F98 (≠ K83) mutation to L: No effect on phenylalanine transport activity.
- F101 (= F86) mutation to L: 38% of wild-type phenylalanine transport activity.
- W105 (= W90) mutation to L: 39% of wild-type phenylalanine transport activity.
- Y107 (≠ V92) mutation to L: No effect on phenylalanine transport activity.
- W108 (≠ L93) mutation to L: 71% of wild-type phenylalanine transport activity.
- F111 (≠ Y96) mutation to L: 60% of wild-type phenylalanine transport activity.; mutation to Y: Enables the transport of tryptophan to almost the same steady-state level as that of phenylalanine.
- E118 (≠ I103) mutation E->G,L,V,N: Loss of activity.
- K168 (≠ Q153) mutation K->L,R: Strong decrease in phenylalanine transport activity.; mutation to N: Loss of activity.
- E226 (≠ D207) mutation E->A,Q,K,R,W: Loss of activity.
- R252 (≠ I233) mutation R->D,E,F,W,P: Loss of activity.
- P341 (= P324) mutation to A: 5% of wild-type phenylalanine transport activity.; mutation P->G,Q,K,R: Loss of activity.; mutation to S: 3% of wild-type phenylalanine transport activity.; mutation to T: 17% of wild-type phenylalanine transport activity.
Sites not aligning to the query:
- 26 mutation R->G,S,Q: Strong decrease in phenylalanine transport activity.
- 54 P→A: 50% of wild-type phenylalanine transport activity.; P→G: No change in phenylalanine transport activity.; P→L: 26% of wild-type phenylalanine transport activity.
- 442 P→A: 46% of wild-type phenylalanine transport activity.; P→G: 52% of wild-type phenylalanine transport activity.; P→L: 43% of wild-type phenylalanine transport activity.
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
27% identity, 83% coverage: 3:366/441 of query aligns to 27:428/629 of P30825
- N226 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
24% identity, 72% coverage: 27:342/441 of query aligns to 35:351/457 of P15993
- Y103 (= Y96) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
P25737 Lysine-specific permease LysP; Lysine transporter LysP; Trigger transporter LysP from Escherichia coli (strain K12) (see 2 papers)
24% identity, 69% coverage: 33:338/441 of query aligns to 43:359/489 of P25737
- Y102 (≠ V92) mutation to L: Retains 4% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- W106 (≠ Y96) mutation to L: Retains 20% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- K163 (≠ Q153) mutation to A: Retains 24% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- F216 (≠ Y201) mutation to L: Retains 13% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- E222 (≠ D207) mutation to A: Abolishes lysine uptake. Strongly inhibits CadC.
- E230 (= E215) mutation to V: Abolishes lysine uptake. Shows significant less inhibition of CadC.
- D275 (≠ S256) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-278.
- D278 (≠ S259) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-275.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 438 E→A: Retains 14% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 443 D→A: Retains 11% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 446 D→A: Retains 13% of wild-type lysine uptake activity. Is unable to inhibit CadC.
7p9uB Cryo em structure of system xc- in complex with glutamate (see paper)
23% identity, 82% coverage: 31:392/441 of query aligns to 24:392/455 of 7p9uB
7epzB Overall structure of erastin-bound xct-4f2hc complex (see paper)
23% identity, 82% coverage: 31:392/441 of query aligns to 24:392/453 of 7epzB
Sites not aligning to the query:
Q9UPY5 Cystine/glutamate transporter; Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Solute carrier family 7 member 11; xCT from Homo sapiens (Human) (see 4 papers)
23% identity, 82% coverage: 31:392/441 of query aligns to 68:436/501 of Q9UPY5
- C86 (≠ A48) mutation to S: Does not affect L-cystine transport activity; when associated with S-158; S-197; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-158; S-197; S-271; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-158; S-197; S-271; S-327; S-414 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- R135 (≠ L99) binding ; mutation to A: Loss of L-cystine transport activity.; mutation to K: Loss of L-cystine transport activity.
- C158 (≠ S113) modified: Interchain (with C-210 in SLC3A2); mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- Q191 (≠ N146) mutation to A: Increases sensitivity to erastin-induced ferroptosis.
- C197 (≠ V152) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-271; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-271; S-327; S-414 and S-435.
- K198 (≠ Q153) mutation to A: Loss of L-cystine transport activity. Does not affect location at the celle membrane. Does not affect expression level.
- Y244 (= Y201) binding
- F254 (≠ T211) mutation to A: Increases resistance to erastin-induced ferroptosis. Decreases sensitivity to erastin-induced inhibition of L-cystine transport activity.
- C271 (vs. gap) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-327; S-414 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- C327 (≠ I282) mutation to A: Does not affect L-glutamate transport activity. Does not affect location at cell membrane Does not affect expression level.; mutation to L: Loss of L-glutamate transport activity. Does not affect location at cell membrane. Does not affect expression level.; mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-271; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-271; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-271; S-414 and S-435. Loss of inhibitio nof L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid. Decrease L-glutamate transport activity. Does not affect location at cell membrane. Does not affect expression level.; mutation to T: Does not affect L-glutamate transport activity. Does not affect location at cell membrane. Does not affect expression level.
- F336 (≠ S291) mutation to A: Decreases L-cystine transport activity about 50%. Increases sensitivity to erastin-induced ferroptosis. Significantly decreases the L-cystine transport activity.; mutation to Y: Does not affect L-cystine transport activity.
- R396 (≠ A354) mutation to A: Loss of L-cystine transport activity.; mutation to K: Loss of L-cystine transport activity.; mutation to N: Loss of L-cystine transport activity.
- C414 (≠ G372) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-271; S-327 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-271; S-327 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-271; S-327 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- C435 (≠ G391) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-271; S-327 and S-414. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-271; S-327 and S-414. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-271; S-327 and S-414. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
Q9URZ4 Cationic amino acid transporter 1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 41% coverage: 50:230/441 of query aligns to 127:311/587 of Q9URZ4
Sites not aligning to the query:
- 29 modified: Phosphoserine
- 30 modified: Phosphoserine
- 37 modified: Phosphoserine
3l1lA Structure of arg-bound escherichia coli adic (see paper)
24% identity, 68% coverage: 36:334/441 of query aligns to 31:316/423 of 3l1lA
Sites not aligning to the query:
7cmiB The lat2-4f2hc complex in complex with leucine (see paper)
24% identity, 81% coverage: 36:392/441 of query aligns to 27:391/458 of 7cmiB
Sites not aligning to the query:
7cmhB The lat2-4f2hc complex in complex with tryptophan (see paper)
24% identity, 81% coverage: 36:392/441 of query aligns to 27:391/458 of 7cmhB
Sites not aligning to the query:
5j4nA Crystal structure of the l-arginine/agmatine antiporter adic in complex with agmatine at 2.6 angstroem resolution (see paper)
21% identity, 68% coverage: 36:334/441 of query aligns to 33:329/437 of 5j4nA
Sites not aligning to the query:
P60061 Arginine/agmatine antiporter from Escherichia coli (strain K12) (see 3 papers)
23% identity, 47% coverage: 36:243/441 of query aligns to 37:239/445 of P60061
- Y93 (≠ V92) mutation to L: Greatly decreased Arg uptake into liposomes.
- A96 (≠ D95) binding ; binding
- C97 (≠ Y96) binding
- N101 (≠ P100) binding ; mutation to A: Vmax for Arg-Agm exchange 1% of wild-type, KM increases 3-fold.; mutation to D: Nearly wild-type Arg-Agm exchange.
- M104 (≠ I103) binding ; mutation to A: 30% decreased affinity for Arg, 50% decreased affinity for Agm.
- W202 (≠ Y201) binding ; mutation to L: Halves Arg uptake into liposomes.
- S203 (= S202) binding
- I205 (≠ L204) binding ; binding ; mutation to A: About wild-type affinity for Arg and Agm.
Sites not aligning to the query:
- 23 binding ; binding
- 26 binding
- 293 binding ; mutation W->C,H,L: Loss of Arg-Agm exchange.; mutation W->F,Y: Less than 20% Arg-Agm exchange activity. Vmax 15% of wild-type rate.
- 357 binding ; S→A: 20% decreased affinity for Arg, 40% decrease affinity for Agm.
P60063 Arginine/agmatine antiporter from Escherichia coli O157:H7 (see 3 papers)
23% identity, 47% coverage: 36:243/441 of query aligns to 37:239/445 of P60063
- Y74 (= Y73) mutation to A: 50% antiport activity at pH 6.0, 10-fold higher than wild-type antiport activity at pH 7.5, i.e. loss of pH-dependence of substrate transport. No change in binding of Arg or Agm.; mutation Y->C,H,L,M,Q,S: Loss of pH-dependence of substrate transport.; mutation to F: Approximately wild-type antiport.
- Y87 (≠ F86) mutation to A: Markedly reduced binding affinity for Agm but not for Arg. 50% Agm antiport.
- Y93 (≠ V92) mutation to A: Reduced binding affinity for Arg, no binding to Agm. 25% Agm antiport.; mutation to K: Almost no binding to both Arg and Agm. 5% Agm antiport.
- A96 (≠ D95) binding
- C97 (≠ Y96) binding
- N101 (≠ P100) binding
- W202 (≠ Y201) Periplasmic (proximal) gate; binding
- I205 (≠ L204) binding
- GVESA 206:210 (≠ GFDAV 205:209) Helix-breaking GVESA motif TM6
- E208 (≠ D207) mutation E->A,D: 5-10% Agm antiport.
Sites not aligning to the query:
- 22 N→A: No change in antiport activity, 6-fold higher affinity for Arg.
- 23 binding
- 25:27 Helix-breaking GSG motif TM1
- 26 binding ; S→K: 5% Agm antiport.
- 27 binding
- 293 binding
- 337 F→A: Severely decreased antiport.
- 357 binding
- 365 Y→A: Markedly weakened binding to Arg but not to Agm. 5% Agm antiport.
6f2wA Bacterial asc transporter crystal structure in open to in conformation (see paper)
22% identity, 89% coverage: 7:399/441 of query aligns to 11:399/433 of 6f2wA
P46349 Gamma-aminobutyric acid permease; GABA permease; 4-aminobutyrate permease; Gamma-aminobutyrate permease; Proline transporter GabP from Bacillus subtilis (strain 168) (see paper)
21% identity, 92% coverage: 27:431/441 of query aligns to 32:449/469 of P46349
- G33 (= G28) mutation to D: Lack of activity.
- G42 (≠ T37) mutation to S: Lack of activity.
- G301 (≠ A292) mutation to V: Lack of activity.
- G338 (≠ C331) mutation to E: Lack of activity.
- F341 (≠ V334) mutation to S: Lack of activity.
- G414 (≠ A394) mutation to R: Lack of activity.
7dsqB Overall structure of the lat1-4f2hc bound with 3,5-diiodo-l-tyrosine (see paper)
25% identity, 84% coverage: 4:375/441 of query aligns to 3:379/464 of 7dsqB
Query Sequence
>PfGW456L13_4782 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4782
MARLQRTLSLGSVVLFGIAYMTPIIVLGTFGILAQSTAGMVPAAYLAALVAMFFTAMSYG
RMASAFPVAGSAYSYVRKAISPKLGFIAGWAVLLDYLFLPMAIWLIGAAYLNSAFPAVPQ
WVWVLAFISITSAINIVGLKLANGINALLMLVQFLVLIAFVALCVHYVGGDASTPLWSIK
PFFNGDMQMPLIMSGAAIACYSFLGFDAVSTLTEETRDPRRTIPRAIMLITLIGGLIFVG
VSYFVQIAHPSFQFDSVDSAAYEIARNIGGDLFVSIFLIGLIVGQFASGLSAQASGSRLL
YAMGRDGVLPKSFFGTLHERFGTPINSILLCAVVALLALKLDVTTSTSFINFGAFLAFSL
VNLSVIFHYWIGGEKKGPREFVLFLLFPFIGLSADLWLMVSLDHLAVYLGLSWLAIGVVY
LAVLTGGFRRQPPEMDFQEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory