SitesBLAST
Comparing PfGW456L13_4977 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4977 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
26% identity, 97% coverage: 7:235/236 of query aligns to 9:242/250 of 5bt9C
- active site: R18 (= R16), I140 (= I133), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R16), I19 (≠ V17), C38 (≠ S35), N39 (≠ Y36), R40 (= R37), S41 (= S38), L66 (≠ S60), E67 (= E61), N90 (= N84), S92 (= S86), I140 (= I133), K159 (= K152), P184 (= P177), G185 (≠ A178), T187 (≠ L180), L188 (= L181)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
28% identity, 96% coverage: 9:234/236 of query aligns to 10:239/241 of 5t2uA
- active site: G17 (≠ R16), T135 (≠ D135), T145 (≠ H145), Y148 (= Y148), K152 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (≠ R16), R38 (= R37), D39 (≠ S38), R42 (≠ P41), D60 (≠ E61), L61 (≠ A62), N83 (= N84), A84 (= A85), Y87 (≠ W88), I133 (= I133), T135 (≠ D135), Y148 (= Y148), K152 (= K152), P178 (= P177), P180 (≠ L179), T181 (≠ L180), T183 (vs. gap), T185 (vs. gap), T186 (vs. gap)
6rx6A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 4 (nmt- c0026) (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6rx6A
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R16), S94 (= S86), F96 (≠ W88), Y154 (= Y148), P190 (≠ N183), M193 (≠ D186), W201 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180)
6rx0A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 3 (nmt- c0013) (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6rx0A
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-ethyl-amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R16), S94 (= S86), F96 (≠ W88), P98 (vs. gap), F151 (≠ H145), Y154 (= Y148), P190 (≠ N183), M193 (≠ D186), W201 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), K158 (= K152), P184 (= P177), S187 (≠ L180)
6howA Trypanosoma brucei ptr1 in complex with the triazine inhibitor 2a (f219). (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6howA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding (2~{R})-1-(3,4-dichlorophenyl)-2-(4-nitrophenyl)-2~{H}-1,3,5-triazine-4,6-diamine: S94 (= S86), F96 (≠ W88), Y154 (= Y148), L189 (≠ F182), P190 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), D141 (= D135), K158 (= K152), G185 (≠ A178), V186 (≠ L179), S187 (≠ L180)
6gexA Trypanosoma brucei ptr1 in complex with inhibitor 2h (f246) (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6gexA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding 4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]-~{N}-(phenylmethyl)benzamide: S94 (= S86), F96 (≠ W88), C148 (≠ S142), Y154 (= Y148), P190 (≠ N183), M193 (≠ D186), W201 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T115 (≠ V106), L139 (≠ I133), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
6gdoA Trypanosoma brucei ptr1 in complex with inhibitor 2g (f240) (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6gdoA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding methyl 1-[4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S86), F96 (≠ W88), C148 (≠ S142), Y154 (= Y148), M193 (≠ D186), W201 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), D141 (= D135), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
5k6aA Trypanosoma brucei pteridine reductase 1 (ptr1) in complex with compound 1 (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 5k6aA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding (2~{R})-2-(3-hydroxyphenyl)-6-oxidanyl-2,3-dihydrochromen-4-one: S94 (= S86), F96 (≠ W88), Y154 (= Y148), V186 (≠ L179), P190 (≠ N183), W201 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), D141 (= D135), K158 (= K152), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
2x9nA High resolution structure of tbptr1 in complex with cyromazine (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 2x9nA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding N~2~-cyclopropyl-1,3,5-triazine-2,4,6-triamine: R13 (= R16), S94 (= S86), F96 (≠ W88), Y154 (= Y148), L188 (= L181), P190 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), C140 (≠ S134), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
26% identity, 100% coverage: 1:235/236 of query aligns to 1:243/244 of 6wprA
- active site: G16 (≠ R16), S138 (≠ D135), Y151 (= Y148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), T37 (≠ R37), L58 (≠ A56), D59 (= D57), V60 (≠ F58), N86 (= N84), A87 (= A85), G88 (≠ S86), I89 (vs. gap), I136 (= I133), Y151 (= Y148), K155 (= K152), P181 (= P177)
3jq8A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6,7,7- trimethyl-7,8-dihydropteridine-2,4-diamine (dx3) (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 3jq8A
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine: S94 (= S86), F96 (≠ W88), Y155 (= Y148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ S35), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), C141 (≠ S134), D142 (= D135), K159 (= K152), P185 (= P177), G186 (≠ A178), S188 (≠ L180)
8jfhD Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery (see paper)
26% identity, 100% coverage: 1:235/236 of query aligns to 2:238/238 of 8jfhD
5jdcA Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 5jdcA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding (2S)-5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-2,3-dihydro-4H-1-benzopyran-4-one: F96 (≠ W88), D142 (= D135), M144 (≠ V137), C149 (≠ S142), L189 (= L181), L190 (≠ F182), P191 (≠ N183), W202 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T116 (≠ V106), L140 (≠ I133), K159 (= K152), G186 (≠ A178), S188 (≠ L180), L189 (= L181)
5jcxA Trypanosoma brucei ptr1 in complex with inhibitor np-29 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 5jcxA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding 3,5,7-trihydroxy-2-(2-hydroxyphenyl)-4H-1-benzopyran-4-one: F96 (≠ W88), Y155 (= Y148), P191 (≠ N183), M194 (≠ D186), W202 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ S35), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), K159 (= K152), P185 (= P177), G186 (≠ A178), S188 (≠ L180), L189 (= L181)
5jcjA Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 5jcjA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding 2-(3,4-dihydroxyphenyl)-3,6-dihydroxy-4H-1-benzopyran-4-one: S94 (= S86), F96 (≠ W88), Y155 (= Y148), L189 (= L181), L190 (≠ F182), W202 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ S35), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), D142 (= D135), K159 (= K152), G186 (≠ A178), S188 (≠ L180), L189 (= L181)
5izcA Trypanosoma brucei ptr1 in complex with inhibitor f032 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 5izcA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding N~2~-[(thiophen-2-yl)methyl]-1,3,4-thiadiazole-2,5-diamine: S94 (= S86), F96 (≠ W88), C149 (≠ S142), Y155 (= Y148), V187 (≠ L179), L190 (≠ F182), P191 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ Q15), R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), K159 (= K152), P185 (= P177), G186 (≠ A178), S188 (≠ L180), L189 (= L181)
4wcfA Trypanosoma brucei ptr1 in complex with inhibitor 9 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 4wcfA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding 3-(5-amino-1,3,4-thiadiazol-2-yl)pyridin-4-amine: S94 (= S86), F96 (≠ W88), Y155 (= Y148), P191 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), C141 (≠ S134), D142 (= D135), K159 (= K152), G186 (≠ A178), V187 (≠ L179), S188 (≠ L180)
4cmeA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 4cmeA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding N4,N4-dimethyl-5,6-diphenyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), M144 (≠ V137), C149 (≠ S142), Y155 (= Y148), G186 (≠ A178), L190 (≠ F182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), D142 (= D135), K159 (= K152), P185 (= P177), V187 (≠ L179), S188 (≠ L180)
4cm9A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 4cm9A
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), K159 (= K152), P185 (= P177), G186 (≠ A178), V187 (≠ L179), S188 (≠ L180)
- binding 2-amino-5,6-diphenyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S86), F96 (≠ W88), D142 (= D135), M144 (≠ V137), C149 (≠ S142), Y155 (= Y148), G186 (≠ A178), L190 (≠ F182), P191 (≠ N183), M194 (≠ D186)
3jqgA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6-[(4- methoxybenzyl)sulfanyl]pyrimidine-2,4-diamine (ax6) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 3jqgA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding 6-[(4-methoxybenzyl)sulfanyl]pyrimidine-2,4-diamine: R13 (= R16), S94 (= S86), F96 (≠ W88), Y155 (= Y148), P191 (≠ N183), W202 (≠ A194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), S94 (= S86), T116 (≠ V106), L140 (≠ I133), C141 (≠ S134), K159 (= K152), P185 (= P177), G186 (≠ A178), V187 (≠ L179), S188 (≠ L180)
Query Sequence
>PfGW456L13_4977 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4977
MTSSAAPVLITGAGQRVGLHCARRLLEDGHRVIFSYRSERPGVQTLRDLGATAVFADFAS
EAGIFAFINELKTHTDSLRAIVHNASEWLAETPDTDAAAFTRMFSVHMLAPYLINLHCAD
LLQRSSPADIVHISDDVTRKGSSRHIGYCASKAGLDSLTLSFAARYAPAIKVNGIAPALL
LFNPEDDAAYRAKALAKSALGIEPGCEVIYQSLRYLLDNPYVTGTTLTVNGGRHIK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory