Comparing RR42_RS00385 FitnessBrowser__Cup4G11:RR42_RS00385 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
61% identity, 99% coverage: 2:279/280 of query aligns to 7:281/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
61% identity, 99% coverage: 2:279/280 of query aligns to 7:281/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
40% identity, 94% coverage: 16:278/280 of query aligns to 3:277/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
37% identity, 99% coverage: 1:278/280 of query aligns to 2:276/277 of 6iymA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
43% identity, 71% coverage: 72:270/280 of query aligns to 94:294/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
43% identity, 71% coverage: 72:270/280 of query aligns to 95:295/303 of 8sutA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
43% identity, 74% coverage: 71:277/280 of query aligns to 63:248/252 of 3qdfA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
38% identity, 75% coverage: 62:271/280 of query aligns to 55:255/265 of 3r6oA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
40% identity, 73% coverage: 66:269/280 of query aligns to 8:206/216 of 6sbiA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
41% identity, 71% coverage: 71:270/280 of query aligns to 69:270/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
41% identity, 71% coverage: 71:270/280 of query aligns to 69:270/280 of 6j5xA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
39% identity, 73% coverage: 66:269/280 of query aligns to 14:212/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
39% identity, 73% coverage: 66:269/280 of query aligns to 9:207/218 of 6fogA
1gttA Crystal structure of hpce (see paper)
44% identity, 64% coverage: 70:247/280 of query aligns to 223:392/421 of 1gttA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
37% identity, 74% coverage: 71:277/280 of query aligns to 63:267/269 of 4dbhA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
38% identity, 81% coverage: 52:277/280 of query aligns to 60:261/264 of 6jvwB
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
38% identity, 64% coverage: 69:247/280 of query aligns to 15:197/224 of 3v77A
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
35% identity, 75% coverage: 69:277/280 of query aligns to 23:231/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
32% identity, 63% coverage: 71:247/280 of query aligns to 10:210/247 of 1nkqA
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
26% identity, 57% coverage: 84:242/280 of query aligns to 106:270/343 of 3lzkC
Sites not aligning to the query:
>RR42_RS00385 FitnessBrowser__Cup4G11:RR42_RS00385
MKLVRVGKPGAERPGLIDAEGRVRDLSGVLDGLGPQALSAEALARLARLDPATLPVVQAE
RFGVPWTGIGKIVAIGLNYADHAAEAGMALPAEPIVFLKANSSLNGPNDPVMLPRGSEKT
DWEVELGVVIGKVARDVSLADALSHVAGYCVVNDVSEREFQIERGGTWDKGKGCDTFCPV
GPWLVTRDEVPDPQALGLWLDVNGQRVQKGSTATMVFDVATLVSYVSRFMTLHPGDLICT
GTPPGVGMGFKPPRFLKAGDTMRLGIDGLGEQGQTVVAYA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory