Comparing RR42_RS00755 FitnessBrowser__Cup4G11:RR42_RS00755 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
39% identity, 91% coverage: 15:268/280 of query aligns to 6:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
34% identity, 93% coverage: 14:273/280 of query aligns to 5:268/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
34% identity, 93% coverage: 14:273/280 of query aligns to 5:265/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
34% identity, 93% coverage: 14:273/280 of query aligns to 5:262/262 of 6eb3C
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
30% identity, 90% coverage: 16:268/280 of query aligns to 13:267/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
30% identity, 90% coverage: 16:268/280 of query aligns to 13:267/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
30% identity, 90% coverage: 16:268/280 of query aligns to 13:267/278 of 4uhfA
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
25% identity, 88% coverage: 25:271/280 of query aligns to 17:269/269 of 5h3hB
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 10:261/268 of 4ihaA
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
25% identity, 87% coverage: 25:268/280 of query aligns to 15:269/271 of 3heaA
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 7:258/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 7:258/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 7:258/265 of 5yz7A
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 8:259/266 of 6ap8A
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 6:257/264 of 5zhsA
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 8:259/266 of 5dj5A
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
25% identity, 87% coverage: 25:268/280 of query aligns to 15:269/271 of 3hi4A
6brtA F-box protein cth with hydrolase (see paper)
27% identity, 88% coverage: 20:264/280 of query aligns to 27:278/285 of 6brtA
3b12A Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. Fa1 in complex with fluoroacetate (see paper)
38% identity, 42% coverage: 9:125/280 of query aligns to 6:126/294 of 3b12A
Sites not aligning to the query:
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
27% identity, 88% coverage: 20:264/280 of query aligns to 60:311/318 of Q10QA5
>RR42_RS00755 FitnessBrowser__Cup4G11:RR42_RS00755
MSATLPPSETRRVRVGDISLHVRIDGGDGPWVVLAHALGANHTLWDATARHLAPRYRVLR
YDLRGHGQSDAPIGAYSMIRLADDAACLMDVMEVPAAHFVGVSVGGMIGQTAAVRHPERL
LSLTLAATVNRTPLDVHPMWHERIGHVEAHGMAGVADSTMQRWFSAAFRGAHPQEVARVR
EMLLATPVHGYVGTCQAIMAFDLAGAISRIHCPTLVVAGEEDLGAPPAMAREIAGAIPGA
RLEILPHAAHLAHIEQAERFHAVLDAFLGNAACGAQCDVP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory