Comparing RR42_RS04555 FitnessBrowser__Cup4G11:RR42_RS04555 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
50% identity, 100% coverage: 1:343/344 of query aligns to 1:343/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
49% identity, 100% coverage: 1:343/344 of query aligns to 2:344/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
49% identity, 100% coverage: 1:343/344 of query aligns to 2:344/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
49% identity, 100% coverage: 1:343/344 of query aligns to 2:344/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
43% identity, 71% coverage: 1:245/344 of query aligns to 2:240/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 67% coverage: 16:245/344 of query aligns to 12:240/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
41% identity, 71% coverage: 1:245/344 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
41% identity, 71% coverage: 1:245/344 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
41% identity, 71% coverage: 1:245/344 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
41% identity, 71% coverage: 1:245/344 of query aligns to 3:242/242 of 2oljA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
43% identity, 64% coverage: 1:219/344 of query aligns to 1:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
43% identity, 64% coverage: 1:219/344 of query aligns to 1:215/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
42% identity, 64% coverage: 1:219/344 of query aligns to 1:215/218 of 8hd0A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 64% coverage: 1:219/344 of query aligns to 1:223/232 of 1f3oA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 64% coverage: 1:220/344 of query aligns to 2:218/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
42% identity, 64% coverage: 1:220/344 of query aligns to 1:217/229 of A5U7B7
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 64% coverage: 1:220/344 of query aligns to 2:218/225 of 8iddA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 64% coverage: 1:219/344 of query aligns to 1:223/230 of 1l2tA
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
38% identity, 64% coverage: 1:220/344 of query aligns to 3:218/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
38% identity, 64% coverage: 1:220/344 of query aligns to 3:218/229 of 6z67B
>RR42_RS04555 FitnessBrowser__Cup4G11:RR42_RS04555
MIELQGLSQRFPGGSGEVHALRDVNLSIAAGEVFGIIGRSGAGKSTLVRAINLLNRPSAG
RVFVAGQELTALDSGALRRARRDIGMIFQHFNLLSSRTVYDNVALPLELAGKSRSEISDT
VLPLLELVGLTALKDRYPAQISGGQKQRVGIARALASKPKVLLSDEATSALDPETTRSIL
ELLKQINRELGLTIVMITHQMEVIKQVCDRVAVLEAGQVVETGRVIDVFLRPQHAVTRAM
IGDVIAQELPQSVLKRVESRLGNGRDHVYRLAFTGAGVDQPVLAQAIRRYGLDFNILHGH
IDEIQGQAFGSLAIMATGDLADVKAAMEYLQQEGVVVEEIEHVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory