Comparing RR42_RS05075 FitnessBrowser__Cup4G11:RR42_RS05075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7k13C Acmsd in complex with diflunisal derivative 14 (see paper)
70% identity, 97% coverage: 7:332/337 of query aligns to 4:330/331 of 7k13C
7k12A Acmsd in complex with diflunisal (see paper)
70% identity, 97% coverage: 7:332/337 of query aligns to 4:330/331 of 7k12A
2hbvA Crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd) (see paper)
70% identity, 97% coverage: 7:332/337 of query aligns to 4:330/331 of 2hbvA
4ergA Evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase (see paper)
70% identity, 97% coverage: 7:332/337 of query aligns to 4:330/332 of 4ergA
4eraA Evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase (see paper)
70% identity, 97% coverage: 7:332/337 of query aligns to 4:330/332 of 4eraA
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
40% identity, 97% coverage: 7:332/337 of query aligns to 3:330/336 of Q8TDX5
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
40% identity, 97% coverage: 7:332/337 of query aligns to 2:329/334 of 7pwyA
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
40% identity, 97% coverage: 7:332/337 of query aligns to 3:330/335 of 4ofcA
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
40% identity, 97% coverage: 7:332/337 of query aligns to 3:330/332 of 4ih3A
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
40% identity, 97% coverage: 7:332/337 of query aligns to 3:330/332 of 2wm1A
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
38% identity, 97% coverage: 7:332/337 of query aligns to 2:300/301 of 7pwyC
4hjwC Crystal structure of metarhizium anisopliae idcase in apo form (see paper)
25% identity, 96% coverage: 2:326/337 of query aligns to 5:368/378 of 4hjwC
4infA Crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium
29% identity, 80% coverage: 62:332/337 of query aligns to 72:351/351 of 4infA
Sites not aligning to the query:
4qrnA High-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid
29% identity, 80% coverage: 62:332/337 of query aligns to 73:352/352 of 4qrnA
Sites not aligning to the query:
4hk6A Crystal structure of cordyceps militaris idcase in complex with 5- nitro-uracil (see paper)
24% identity, 97% coverage: 6:332/337 of query aligns to 3:360/369 of 4hk6A
4hk5D Crystal structure of cordyceps militaris idcase in apo form (see paper)
24% identity, 97% coverage: 6:332/337 of query aligns to 4:361/380 of 4hk5D
Sites not aligning to the query:
4hk7A Crystal structure of cordyceps militaris idcase in complex with uracil (see paper)
24% identity, 97% coverage: 6:332/337 of query aligns to 3:360/379 of 4hk7A
Sites not aligning to the query:
4lalA Crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil (see paper)
24% identity, 97% coverage: 6:332/337 of query aligns to 3:360/368 of 4lalA
4ni8A Crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis complexed with mn and 5-methoxyisophtalic acid
28% identity, 93% coverage: 17:330/337 of query aligns to 5:332/335 of 4ni8A
4ng3A Crystal structure of 5-carboxyvanillate decarboxylase from sphingomonas paucimobilis complexed with 4-hydroxy-3-methoxy-5- nitrobenzoic acid
28% identity, 93% coverage: 17:330/337 of query aligns to 5:332/335 of 4ng3A
>RR42_RS05075 FitnessBrowser__Cup4G11:RR42_RS05075
MSANSVVDIHSHFFPPISRREAAALDPVAAPWLQANGTDTAMIMTGDQPFRPVYSALWDP
ARRIEEMDRCGVDIQLMCATPVMFGYRYPAHVAVPWSQRMNDYALELCAHRPARLKALAQ
VPLQDIDAACREASRAKAGGHVGVQIGNHLGERDLDDEGLITFLIHCANEGIAVLVHPWD
MMGAPRMKKWMLPWLVSMPAETQLGILSLILSGAFERIPASLKLCFAHGGGSFAFLLGRI
DNAWRHRDIVREDCPHPPSSYVNRFFVDSAVFDPRALKLLVDVMGEDRVMLGSDYPYPLG
EQQVGALIRATDLADAARRKLLGANAAAFFGLGDNKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory