Comparing RR42_RS05150 FitnessBrowser__Cup4G11:RR42_RS05150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
42% identity, 80% coverage: 57:305/312 of query aligns to 35:279/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
42% identity, 80% coverage: 57:305/312 of query aligns to 35:279/290 of 8gsrA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
36% identity, 97% coverage: 5:307/312 of query aligns to 2:303/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
36% identity, 97% coverage: 5:306/312 of query aligns to 3:303/303 of 8sutA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
37% identity, 92% coverage: 14:300/312 of query aligns to 7:271/279 of 6v77B
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
40% identity, 66% coverage: 94:300/312 of query aligns to 15:210/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
40% identity, 66% coverage: 94:300/312 of query aligns to 20:215/224 of Q6P587
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
40% identity, 68% coverage: 94:304/312 of query aligns to 14:213/216 of 6sbiA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
39% identity, 70% coverage: 88:304/312 of query aligns to 64:274/277 of 6iymA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
36% identity, 69% coverage: 93:307/312 of query aligns to 25:233/233 of 6j5yA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
37% identity, 70% coverage: 88:304/312 of query aligns to 58:266/269 of 4dbhA
1gttA Crystal structure of hpce (see paper)
39% identity, 61% coverage: 87:277/312 of query aligns to 218:392/421 of 1gttA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
38% identity, 61% coverage: 116:304/312 of query aligns to 72:247/252 of 3qdfA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
33% identity, 82% coverage: 53:307/312 of query aligns to 29:279/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
33% identity, 82% coverage: 53:307/312 of query aligns to 29:279/280 of 6j5xA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
33% identity, 84% coverage: 16:277/312 of query aligns to 10:238/264 of 6jvwB
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
30% identity, 85% coverage: 43:307/312 of query aligns to 26:263/265 of 3r6oA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 70% coverage: 88:306/312 of query aligns to 12:217/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
27% identity, 63% coverage: 93:288/312 of query aligns to 10:216/247 of 1nkqA
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
25% identity, 84% coverage: 13:275/312 of query aligns to 39:355/419 of 1hyoB
Sites not aligning to the query:
>RR42_RS05150 FitnessBrowser__Cup4G11:RR42_RS05150
MNWHSLATYELAGDKRAGLVVADTLYDLAALGRACEIDPASLPGDMNQVFARWAQHAPLL
ADMAGRAAQLATSGKLAAVDAAATYAVPYQPGRIFGVASNFYDHADEMGTKLAARSESQP
YAFMKAETSVIPTGATVLMPPETAKLDWEVELGVVIGQRCRHVPVEDALSVIAGYTVFND
ISARDLNRRTDYPFTHDWFRGKSFDTFGPMGPWVVPAGCIADPQNLRMSLTVNGETMQDG
NTSQMIFSVAEQIAYLSRILTLQPGDLIATGTPDGVGMGRGVFLKPGDNMVAWIEGIGSI
ENAVALEALAAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory